Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V259

Protein Details
Accession A0A1Y1V259   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
156-177TSKKISRSEKKRGTKVWKKLTIHydrophilic
226-251IQARAMYKSNRAKPKSKNSWRTSSNVHydrophilic
NLS Segment(s)
PositionSequence
160-170ISRSEKKRGTK
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences MSSSTTTSCDPFEVLNVRIKGAPRTYTIIHHILYEFTPRELAKLERVSKSWNKFINSDTELWWNKWMTLVWGQKNIVGASPAPKLSEANLKDLAHLQSQLTFSELNSSSTLNLSDTDAISDSMSYSSSVITLTDVSTCGESNSIAKKANSVCSLNTSKKISRSEKKRGTKVWKKLTIEEYRKQEVRNVFVTSDNEESDSDNTVINQDKTSSSTSNVRGKLTTEEKIQARAMYKSNRAKPKSKNSWRTSSNVSKEWMAFEDYYNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.28
4 0.28
5 0.3
6 0.31
7 0.33
8 0.33
9 0.34
10 0.29
11 0.34
12 0.34
13 0.36
14 0.39
15 0.37
16 0.33
17 0.31
18 0.28
19 0.25
20 0.24
21 0.26
22 0.21
23 0.17
24 0.2
25 0.18
26 0.19
27 0.21
28 0.22
29 0.23
30 0.31
31 0.36
32 0.36
33 0.37
34 0.44
35 0.49
36 0.53
37 0.53
38 0.51
39 0.48
40 0.47
41 0.47
42 0.48
43 0.43
44 0.38
45 0.32
46 0.35
47 0.34
48 0.33
49 0.35
50 0.28
51 0.24
52 0.24
53 0.22
54 0.18
55 0.24
56 0.3
57 0.3
58 0.34
59 0.34
60 0.34
61 0.35
62 0.31
63 0.24
64 0.17
65 0.15
66 0.13
67 0.15
68 0.14
69 0.13
70 0.13
71 0.13
72 0.14
73 0.21
74 0.2
75 0.22
76 0.26
77 0.26
78 0.26
79 0.29
80 0.28
81 0.21
82 0.2
83 0.16
84 0.14
85 0.15
86 0.14
87 0.12
88 0.11
89 0.09
90 0.15
91 0.15
92 0.14
93 0.14
94 0.14
95 0.13
96 0.13
97 0.14
98 0.08
99 0.08
100 0.07
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.06
109 0.05
110 0.06
111 0.05
112 0.05
113 0.04
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.07
129 0.1
130 0.11
131 0.13
132 0.13
133 0.16
134 0.18
135 0.22
136 0.23
137 0.21
138 0.2
139 0.24
140 0.29
141 0.28
142 0.3
143 0.3
144 0.3
145 0.34
146 0.42
147 0.45
148 0.49
149 0.56
150 0.62
151 0.69
152 0.75
153 0.77
154 0.78
155 0.8
156 0.8
157 0.82
158 0.81
159 0.79
160 0.73
161 0.72
162 0.71
163 0.71
164 0.68
165 0.65
166 0.61
167 0.58
168 0.58
169 0.52
170 0.5
171 0.44
172 0.41
173 0.37
174 0.33
175 0.28
176 0.29
177 0.3
178 0.27
179 0.25
180 0.21
181 0.19
182 0.17
183 0.18
184 0.16
185 0.16
186 0.14
187 0.12
188 0.12
189 0.13
190 0.16
191 0.15
192 0.15
193 0.14
194 0.14
195 0.17
196 0.2
197 0.19
198 0.19
199 0.25
200 0.31
201 0.37
202 0.39
203 0.38
204 0.35
205 0.36
206 0.4
207 0.39
208 0.36
209 0.32
210 0.37
211 0.37
212 0.4
213 0.39
214 0.35
215 0.33
216 0.33
217 0.36
218 0.36
219 0.44
220 0.5
221 0.57
222 0.64
223 0.68
224 0.72
225 0.76
226 0.8
227 0.82
228 0.84
229 0.85
230 0.83
231 0.86
232 0.82
233 0.77
234 0.75
235 0.74
236 0.7
237 0.64
238 0.59
239 0.53
240 0.49
241 0.47
242 0.4
243 0.33
244 0.27