Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VKC3

Protein Details
Accession A0A1Y1VKC3    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-106MKVLVYSKKKKEKENIGWYRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 12.333, nucl 11, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR040626  Pepdidase_M14_N  
IPR000834  Peptidase_M14  
Gene Ontology GO:0004181  F:metallocarboxypeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF18027  Pepdidase_M14_N  
PF00246  Peptidase_M14  
Amino Acid Sequences MYYYIQRTVNNCAPPLLFDSRFESGNLQKAIRIDDYAYFLQLKCDLNTNGHVQWFFFQVKNMQGNHEYQFTLGNFTKPKSLFNNGMKVLVYSKKKKEKENIGWYRTGYNISYTKNKKCSNFKQTYLLDMSIVFTEDNDTCYIAYCYPYTYSDLQRDINILKMDNKLFNVLNHEIIGESINKNKIDLITITNNRINNENKKVIIITGRVHPCETNSSFMVKGFIEFMIGNTKEAQYIRDNYIVKIIPMLNPDGVISGNSRCSLTGYDLNRCWRLSEKKLIRYTPEIHTVIKMIEKTLENNSIEMFVDMHGHSRKFGTFLYGCSNDDNEDNRYKERIFPYIFSNYYKQYVYFNRCHFNIEKVKEGTGRVTMHKKYNVLKSYTMEASMCGSDLTSTKENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.36
4 0.3
5 0.28
6 0.33
7 0.32
8 0.33
9 0.32
10 0.3
11 0.28
12 0.35
13 0.35
14 0.3
15 0.3
16 0.31
17 0.34
18 0.31
19 0.28
20 0.22
21 0.21
22 0.26
23 0.25
24 0.25
25 0.23
26 0.21
27 0.22
28 0.24
29 0.24
30 0.19
31 0.25
32 0.25
33 0.26
34 0.3
35 0.32
36 0.3
37 0.31
38 0.3
39 0.25
40 0.24
41 0.26
42 0.25
43 0.21
44 0.21
45 0.22
46 0.28
47 0.34
48 0.33
49 0.33
50 0.33
51 0.36
52 0.36
53 0.35
54 0.28
55 0.22
56 0.26
57 0.21
58 0.25
59 0.22
60 0.25
61 0.24
62 0.25
63 0.32
64 0.29
65 0.33
66 0.32
67 0.37
68 0.42
69 0.45
70 0.52
71 0.46
72 0.47
73 0.43
74 0.38
75 0.35
76 0.34
77 0.36
78 0.36
79 0.45
80 0.53
81 0.58
82 0.66
83 0.72
84 0.75
85 0.78
86 0.81
87 0.82
88 0.76
89 0.74
90 0.66
91 0.58
92 0.48
93 0.4
94 0.29
95 0.24
96 0.24
97 0.24
98 0.33
99 0.37
100 0.44
101 0.5
102 0.55
103 0.57
104 0.64
105 0.71
106 0.72
107 0.73
108 0.69
109 0.69
110 0.64
111 0.62
112 0.54
113 0.44
114 0.34
115 0.26
116 0.24
117 0.15
118 0.14
119 0.09
120 0.06
121 0.08
122 0.08
123 0.09
124 0.09
125 0.09
126 0.08
127 0.1
128 0.11
129 0.09
130 0.1
131 0.09
132 0.09
133 0.11
134 0.12
135 0.14
136 0.17
137 0.2
138 0.22
139 0.24
140 0.24
141 0.23
142 0.24
143 0.21
144 0.21
145 0.19
146 0.16
147 0.16
148 0.18
149 0.2
150 0.19
151 0.19
152 0.18
153 0.18
154 0.18
155 0.21
156 0.19
157 0.18
158 0.16
159 0.16
160 0.13
161 0.12
162 0.13
163 0.08
164 0.08
165 0.1
166 0.13
167 0.13
168 0.13
169 0.14
170 0.13
171 0.13
172 0.13
173 0.14
174 0.18
175 0.2
176 0.23
177 0.25
178 0.26
179 0.25
180 0.28
181 0.29
182 0.28
183 0.32
184 0.31
185 0.29
186 0.28
187 0.28
188 0.24
189 0.22
190 0.18
191 0.14
192 0.19
193 0.21
194 0.21
195 0.21
196 0.2
197 0.19
198 0.23
199 0.22
200 0.18
201 0.17
202 0.18
203 0.18
204 0.18
205 0.18
206 0.12
207 0.11
208 0.09
209 0.08
210 0.08
211 0.07
212 0.08
213 0.12
214 0.13
215 0.13
216 0.13
217 0.13
218 0.14
219 0.14
220 0.16
221 0.14
222 0.17
223 0.19
224 0.24
225 0.25
226 0.23
227 0.28
228 0.25
229 0.22
230 0.21
231 0.19
232 0.15
233 0.16
234 0.17
235 0.12
236 0.12
237 0.12
238 0.1
239 0.09
240 0.08
241 0.08
242 0.08
243 0.09
244 0.1
245 0.1
246 0.09
247 0.1
248 0.11
249 0.14
250 0.19
251 0.21
252 0.26
253 0.29
254 0.34
255 0.35
256 0.34
257 0.31
258 0.32
259 0.37
260 0.38
261 0.45
262 0.49
263 0.55
264 0.62
265 0.62
266 0.59
267 0.58
268 0.56
269 0.5
270 0.49
271 0.42
272 0.36
273 0.35
274 0.31
275 0.26
276 0.25
277 0.21
278 0.13
279 0.16
280 0.16
281 0.18
282 0.21
283 0.26
284 0.24
285 0.24
286 0.23
287 0.21
288 0.2
289 0.18
290 0.14
291 0.08
292 0.1
293 0.1
294 0.14
295 0.17
296 0.17
297 0.17
298 0.19
299 0.19
300 0.18
301 0.19
302 0.21
303 0.19
304 0.21
305 0.27
306 0.27
307 0.28
308 0.28
309 0.28
310 0.22
311 0.24
312 0.25
313 0.23
314 0.27
315 0.28
316 0.29
317 0.32
318 0.31
319 0.36
320 0.37
321 0.4
322 0.37
323 0.36
324 0.39
325 0.43
326 0.44
327 0.41
328 0.41
329 0.36
330 0.36
331 0.35
332 0.3
333 0.3
334 0.37
335 0.41
336 0.45
337 0.48
338 0.51
339 0.51
340 0.55
341 0.5
342 0.51
343 0.53
344 0.49
345 0.51
346 0.47
347 0.5
348 0.47
349 0.47
350 0.41
351 0.37
352 0.36
353 0.35
354 0.42
355 0.44
356 0.49
357 0.53
358 0.55
359 0.57
360 0.63
361 0.64
362 0.6
363 0.58
364 0.54
365 0.54
366 0.5
367 0.44
368 0.35
369 0.28
370 0.27
371 0.22
372 0.19
373 0.13
374 0.12
375 0.11
376 0.12
377 0.18