Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VAF9

Protein Details
Accession A0A1Y1VAF9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-38NAEKRKKSLLELKKKYKNSNNKRQRDESGHydrophilic
NLS Segment(s)
PositionSequence
13-26KRKKSLLELKKKYK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences MDANLNMLNNAEKRKKSLLELKKKYKNSNNKRQRDESGIIDNNEEIVNEITVENIVEKYTKETLDKEKAQSNEINLQNLAPKKPNWDLKRDLEKKLEKLEKKTQICINEIIRERLKQTGDISNIPKAVEEMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.47
4 0.54
5 0.57
6 0.61
7 0.7
8 0.75
9 0.78
10 0.82
11 0.85
12 0.84
13 0.85
14 0.84
15 0.85
16 0.85
17 0.86
18 0.87
19 0.83
20 0.78
21 0.74
22 0.67
23 0.6
24 0.58
25 0.52
26 0.44
27 0.39
28 0.34
29 0.27
30 0.23
31 0.18
32 0.1
33 0.07
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.06
40 0.05
41 0.04
42 0.05
43 0.05
44 0.05
45 0.08
46 0.1
47 0.11
48 0.12
49 0.14
50 0.2
51 0.27
52 0.29
53 0.28
54 0.31
55 0.31
56 0.33
57 0.31
58 0.27
59 0.29
60 0.27
61 0.26
62 0.21
63 0.21
64 0.22
65 0.23
66 0.22
67 0.17
68 0.17
69 0.21
70 0.27
71 0.36
72 0.35
73 0.4
74 0.45
75 0.5
76 0.61
77 0.6
78 0.58
79 0.58
80 0.6
81 0.58
82 0.61
83 0.62
84 0.55
85 0.59
86 0.64
87 0.65
88 0.63
89 0.65
90 0.61
91 0.55
92 0.53
93 0.51
94 0.45
95 0.43
96 0.43
97 0.43
98 0.41
99 0.39
100 0.38
101 0.38
102 0.35
103 0.31
104 0.32
105 0.34
106 0.35
107 0.39
108 0.41
109 0.4
110 0.39
111 0.36
112 0.32