Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1USE6

Protein Details
Accession A0A1Y1USE6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAVGKNKRLSKGKKGLKKKIIDPFTRKEBasic
NLS Segment(s)
PositionSequence
5-19KNKRLSKGKKGLKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027500  Ribosomal_S1/3_euk  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MAVGKNKRLSKGKKGLKKKIIDPFTRKEWYDIKAPNFYENRDIGKTLVNRTQGLKNSSDYLKGSVVDVSVADLTGNQEDAFRKIKLRVDEVQGKNCLTNFHGMNITSDKLKSMVKKWQSLIEAYLDVKTNDGYLLRFFVIAFTQRRRNQLRKTTYAQTAQIRQIRKKIFDIVQKEASNCDIKELVQKLTLEVMGKRIEKECQNIYPLQNVYVRKVKILKAPKFDVGKLMELHGGNDDMGSKVSRAFKEPAIQDSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.87
5 0.85
6 0.84
7 0.84
8 0.83
9 0.8
10 0.76
11 0.74
12 0.72
13 0.65
14 0.6
15 0.55
16 0.48
17 0.49
18 0.49
19 0.46
20 0.47
21 0.48
22 0.5
23 0.48
24 0.47
25 0.44
26 0.4
27 0.39
28 0.34
29 0.34
30 0.27
31 0.31
32 0.32
33 0.32
34 0.34
35 0.32
36 0.32
37 0.35
38 0.4
39 0.39
40 0.39
41 0.36
42 0.33
43 0.34
44 0.34
45 0.33
46 0.28
47 0.25
48 0.23
49 0.2
50 0.19
51 0.15
52 0.14
53 0.11
54 0.1
55 0.08
56 0.07
57 0.06
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.06
64 0.07
65 0.08
66 0.12
67 0.15
68 0.14
69 0.16
70 0.2
71 0.24
72 0.26
73 0.3
74 0.31
75 0.34
76 0.44
77 0.45
78 0.46
79 0.44
80 0.41
81 0.37
82 0.33
83 0.28
84 0.19
85 0.2
86 0.15
87 0.15
88 0.17
89 0.16
90 0.17
91 0.18
92 0.17
93 0.13
94 0.13
95 0.11
96 0.11
97 0.13
98 0.14
99 0.16
100 0.24
101 0.28
102 0.32
103 0.33
104 0.36
105 0.35
106 0.33
107 0.3
108 0.23
109 0.2
110 0.16
111 0.15
112 0.11
113 0.1
114 0.09
115 0.08
116 0.07
117 0.06
118 0.06
119 0.06
120 0.05
121 0.07
122 0.07
123 0.07
124 0.06
125 0.07
126 0.07
127 0.11
128 0.13
129 0.16
130 0.25
131 0.28
132 0.36
133 0.42
134 0.5
135 0.55
136 0.62
137 0.65
138 0.63
139 0.65
140 0.63
141 0.61
142 0.56
143 0.52
144 0.46
145 0.43
146 0.43
147 0.42
148 0.41
149 0.4
150 0.44
151 0.44
152 0.42
153 0.41
154 0.41
155 0.42
156 0.45
157 0.47
158 0.45
159 0.48
160 0.46
161 0.44
162 0.38
163 0.36
164 0.32
165 0.26
166 0.23
167 0.16
168 0.15
169 0.22
170 0.23
171 0.21
172 0.21
173 0.22
174 0.2
175 0.21
176 0.21
177 0.16
178 0.14
179 0.17
180 0.18
181 0.19
182 0.2
183 0.2
184 0.24
185 0.26
186 0.32
187 0.33
188 0.32
189 0.35
190 0.37
191 0.37
192 0.38
193 0.35
194 0.33
195 0.33
196 0.31
197 0.33
198 0.36
199 0.35
200 0.33
201 0.37
202 0.38
203 0.42
204 0.51
205 0.53
206 0.54
207 0.58
208 0.61
209 0.6
210 0.57
211 0.54
212 0.47
213 0.43
214 0.36
215 0.33
216 0.3
217 0.26
218 0.26
219 0.22
220 0.19
221 0.15
222 0.14
223 0.13
224 0.09
225 0.11
226 0.11
227 0.1
228 0.14
229 0.21
230 0.22
231 0.26
232 0.29
233 0.32
234 0.4
235 0.42