Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VD05

Protein Details
Accession A0A1Y1VD05    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-52RKKVTQACENCRKKRRKCTGERPKCLTCKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDNDNELFSLSNNSGNAQGEGKLRKKVTQACENCRKKRRKCTGERPKCLTCKQYNYVCYYNPFPKKRGIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.14
5 0.16
6 0.18
7 0.24
8 0.26
9 0.3
10 0.3
11 0.32
12 0.37
13 0.42
14 0.45
15 0.48
16 0.52
17 0.55
18 0.65
19 0.71
20 0.73
21 0.75
22 0.78
23 0.77
24 0.81
25 0.83
26 0.83
27 0.85
28 0.87
29 0.9
30 0.91
31 0.91
32 0.87
33 0.83
34 0.79
35 0.73
36 0.71
37 0.67
38 0.64
39 0.63
40 0.63
41 0.6
42 0.6
43 0.59
44 0.52
45 0.49
46 0.48
47 0.5
48 0.53
49 0.53
50 0.49