Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V4B3

Protein Details
Accession A0A1Y1V4B3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-159IISNKIYKKFNKSFQKKKKKNSILIFHydrophilic
NLS Segment(s)
PositionSequence
145-153KSFQKKKKK
Subcellular Location(s) nucl 12.5, mito_nucl 10.666, cyto_nucl 9.833, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013809  ENTH  
IPR008942  ENTH_VHS  
Pfam View protein in Pfam  
PF01417  ENTH  
PROSITE View protein in PROSITE  
PS50942  ENTH  
Amino Acid Sequences MDSFKNMTYWDAVGILNKVKNVVMNYSEWEIKVRDATNNEPWGASSTLMKEIARGTYQIDSFNDIMNTIYTRLTECTDDKWRQCYKALQLLEYLIKNGSEKVVKSCHENIYVIRALQKFIYVDPNGKDQGINGIISNKIYKKFNKSFQKKKKKNSILIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.18
4 0.18
5 0.18
6 0.17
7 0.2
8 0.19
9 0.21
10 0.19
11 0.19
12 0.22
13 0.24
14 0.24
15 0.21
16 0.22
17 0.19
18 0.18
19 0.21
20 0.19
21 0.2
22 0.23
23 0.28
24 0.33
25 0.35
26 0.34
27 0.3
28 0.29
29 0.28
30 0.24
31 0.2
32 0.14
33 0.13
34 0.15
35 0.16
36 0.15
37 0.13
38 0.13
39 0.15
40 0.14
41 0.13
42 0.12
43 0.13
44 0.14
45 0.15
46 0.15
47 0.16
48 0.16
49 0.16
50 0.14
51 0.12
52 0.11
53 0.1
54 0.1
55 0.07
56 0.07
57 0.06
58 0.07
59 0.08
60 0.09
61 0.11
62 0.11
63 0.14
64 0.21
65 0.25
66 0.25
67 0.31
68 0.32
69 0.32
70 0.34
71 0.34
72 0.31
73 0.35
74 0.34
75 0.28
76 0.26
77 0.26
78 0.26
79 0.21
80 0.18
81 0.1
82 0.1
83 0.1
84 0.09
85 0.1
86 0.1
87 0.1
88 0.13
89 0.18
90 0.18
91 0.23
92 0.27
93 0.29
94 0.29
95 0.29
96 0.26
97 0.28
98 0.28
99 0.23
100 0.24
101 0.21
102 0.2
103 0.19
104 0.2
105 0.15
106 0.15
107 0.22
108 0.18
109 0.21
110 0.22
111 0.26
112 0.25
113 0.25
114 0.24
115 0.17
116 0.22
117 0.2
118 0.18
119 0.15
120 0.16
121 0.16
122 0.18
123 0.22
124 0.19
125 0.22
126 0.27
127 0.33
128 0.41
129 0.49
130 0.57
131 0.65
132 0.72
133 0.79
134 0.85
135 0.9
136 0.9
137 0.93
138 0.94
139 0.93