Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VFV5

Protein Details
Accession A0A1Y1VFV5    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVKNNKENNRKKANSRQESVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003409  MORN  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF02493  MORN  
Amino Acid Sequences MVKNNKENNRKKANSRQESVIKTNTFIFPDGSTYEGDYKESENGKIVRSGHGKFVSLSNQSTYEGEWVNDEINGKGKIEYANGNSYEGDWLNNKYNGTGTYRWSDGSYYIGEWLENKMNGPGKYYDKNKEVWIGLFINGKSDSLVNEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.77
4 0.74
5 0.74
6 0.7
7 0.66
8 0.56
9 0.48
10 0.47
11 0.4
12 0.34
13 0.28
14 0.24
15 0.17
16 0.19
17 0.18
18 0.16
19 0.14
20 0.14
21 0.16
22 0.15
23 0.15
24 0.14
25 0.14
26 0.18
27 0.19
28 0.17
29 0.19
30 0.2
31 0.2
32 0.23
33 0.23
34 0.24
35 0.27
36 0.27
37 0.29
38 0.29
39 0.29
40 0.26
41 0.27
42 0.25
43 0.23
44 0.23
45 0.17
46 0.17
47 0.17
48 0.17
49 0.15
50 0.13
51 0.11
52 0.1
53 0.09
54 0.09
55 0.08
56 0.08
57 0.09
58 0.07
59 0.09
60 0.1
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.13
67 0.12
68 0.15
69 0.15
70 0.16
71 0.15
72 0.15
73 0.15
74 0.12
75 0.11
76 0.09
77 0.11
78 0.14
79 0.16
80 0.16
81 0.15
82 0.16
83 0.17
84 0.2
85 0.19
86 0.18
87 0.2
88 0.2
89 0.21
90 0.2
91 0.19
92 0.15
93 0.16
94 0.14
95 0.11
96 0.12
97 0.11
98 0.11
99 0.11
100 0.13
101 0.15
102 0.14
103 0.14
104 0.18
105 0.23
106 0.23
107 0.26
108 0.28
109 0.3
110 0.38
111 0.44
112 0.46
113 0.43
114 0.46
115 0.45
116 0.46
117 0.42
118 0.36
119 0.34
120 0.27
121 0.27
122 0.3
123 0.27
124 0.25
125 0.24
126 0.22
127 0.19
128 0.18