Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1V918

Protein Details
Accession A0A1Y1V918    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-109ISNTVTSPKPGKKKKGKKSNKHydrophilic
NLS Segment(s)
PositionSequence
96-109PKPGKKKKGKKSNK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVYIDDWDTFKKAVEELYMASPFKTRYLVKYRNVDTKLVLKVTDGPTCIKYKTEYASDIKKMEKLNRSLLKKMLNTKKSLEAKPLDATISNTVTSPKPGKKKKGKKSNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.18
5 0.2
6 0.19
7 0.18
8 0.19
9 0.18
10 0.18
11 0.21
12 0.18
13 0.23
14 0.33
15 0.4
16 0.45
17 0.52
18 0.55
19 0.6
20 0.6
21 0.54
22 0.46
23 0.44
24 0.4
25 0.32
26 0.28
27 0.2
28 0.23
29 0.25
30 0.24
31 0.2
32 0.18
33 0.2
34 0.22
35 0.22
36 0.17
37 0.16
38 0.16
39 0.18
40 0.18
41 0.19
42 0.2
43 0.24
44 0.26
45 0.26
46 0.25
47 0.26
48 0.27
49 0.3
50 0.33
51 0.32
52 0.38
53 0.44
54 0.48
55 0.47
56 0.48
57 0.48
58 0.46
59 0.53
60 0.53
61 0.5
62 0.49
63 0.49
64 0.54
65 0.55
66 0.53
67 0.5
68 0.44
69 0.43
70 0.42
71 0.4
72 0.32
73 0.26
74 0.27
75 0.23
76 0.22
77 0.19
78 0.16
79 0.18
80 0.18
81 0.22
82 0.27
83 0.31
84 0.4
85 0.5
86 0.61
87 0.7
88 0.8
89 0.85