Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VFJ9

Protein Details
Accession A0A1Y1VFJ9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-38NESNDIRKKSKREIKKAQREMKSTSHydrophilic
NLS Segment(s)
PositionSequence
20-30RKKSKREIKKA
Subcellular Location(s) nucl 15.5, cyto_nucl 8.833, plas 3, E.R. 3, mito 2.5, cyto_mito 2.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATRNRKNIANETNESNDIRKKSKREIKKAQREMKSTSFVTNKYGALFGIFILIFGIIYVAFFGTYIYKRKTGQTTSALNYENPYSRFGDMEALRNAIKIDENGKVVFTGEDMEKFKDILGESVIQNQQNGEENIEEVGNETEENEIPKEESPKEESPKEETPKENEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.44
4 0.41
5 0.38
6 0.42
7 0.43
8 0.45
9 0.53
10 0.61
11 0.68
12 0.73
13 0.8
14 0.84
15 0.88
16 0.92
17 0.91
18 0.89
19 0.83
20 0.79
21 0.73
22 0.67
23 0.57
24 0.53
25 0.47
26 0.4
27 0.39
28 0.35
29 0.29
30 0.25
31 0.24
32 0.17
33 0.14
34 0.13
35 0.09
36 0.09
37 0.08
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.02
45 0.03
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.05
52 0.07
53 0.12
54 0.14
55 0.17
56 0.18
57 0.22
58 0.27
59 0.28
60 0.32
61 0.33
62 0.35
63 0.35
64 0.37
65 0.34
66 0.29
67 0.27
68 0.23
69 0.2
70 0.16
71 0.16
72 0.14
73 0.14
74 0.14
75 0.13
76 0.17
77 0.15
78 0.18
79 0.17
80 0.17
81 0.17
82 0.17
83 0.16
84 0.11
85 0.11
86 0.08
87 0.1
88 0.1
89 0.12
90 0.12
91 0.12
92 0.12
93 0.11
94 0.1
95 0.08
96 0.08
97 0.07
98 0.1
99 0.11
100 0.13
101 0.13
102 0.13
103 0.12
104 0.13
105 0.13
106 0.11
107 0.11
108 0.12
109 0.12
110 0.18
111 0.2
112 0.18
113 0.18
114 0.17
115 0.17
116 0.19
117 0.2
118 0.16
119 0.13
120 0.13
121 0.14
122 0.14
123 0.12
124 0.09
125 0.09
126 0.07
127 0.07
128 0.07
129 0.08
130 0.09
131 0.11
132 0.1
133 0.11
134 0.12
135 0.15
136 0.19
137 0.19
138 0.23
139 0.28
140 0.35
141 0.41
142 0.43
143 0.44
144 0.47
145 0.54
146 0.57
147 0.56
148 0.54
149 0.53