Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UXC7

Protein Details
Accession A0A1Y1UXC7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLRKQLKKKKKVKKQKNNQGQGQGPYHydrophilic
NLS Segment(s)
PositionSequence
4-16KQLKKKKKVKKQK
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MLRKQLKKKKKVKKQKNNQGQGQGPYGQAGYKRDVPQGNYGAPAPGYGAPGYGAPAPGYGAPGYGAPAPGFGGPGFGGPGYGAPRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.96
4 0.95
5 0.91
6 0.88
7 0.81
8 0.73
9 0.65
10 0.55
11 0.44
12 0.35
13 0.28
14 0.2
15 0.17
16 0.16
17 0.16
18 0.2
19 0.22
20 0.26
21 0.28
22 0.29
23 0.32
24 0.33
25 0.3
26 0.25
27 0.23
28 0.18
29 0.16
30 0.14
31 0.09
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.07
64 0.08
65 0.07
66 0.09