Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UZP4

Protein Details
Accession A0A1Y1UZP4   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKAKRKAVVRKKPVLDTQBasic
NLS Segment(s)
PositionSequence
3-15KRKAKRKAVVRKK
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAKRKAVVRKKPVLDTQFNCLFCNHEKSISVKMIQETKVGELRCRVCGANYQSPINSLSHPIDVYSDWIDACEELNPGSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.79
4 0.75
5 0.72
6 0.63
7 0.61
8 0.58
9 0.53
10 0.47
11 0.39
12 0.35
13 0.29
14 0.33
15 0.27
16 0.22
17 0.22
18 0.24
19 0.29
20 0.28
21 0.26
22 0.21
23 0.22
24 0.24
25 0.23
26 0.22
27 0.17
28 0.17
29 0.2
30 0.18
31 0.17
32 0.18
33 0.19
34 0.19
35 0.2
36 0.19
37 0.16
38 0.23
39 0.28
40 0.31
41 0.32
42 0.32
43 0.3
44 0.32
45 0.32
46 0.27
47 0.21
48 0.17
49 0.16
50 0.16
51 0.16
52 0.15
53 0.15
54 0.14
55 0.16
56 0.14
57 0.13
58 0.11
59 0.12
60 0.12
61 0.11
62 0.11
63 0.09
64 0.09