Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VBT2

Protein Details
Accession A0A1Y1VBT2   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MILLPKKTPQKTPSSRRRNSMCGDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024977  Apc4-like_WD40_dom  
IPR033010  Cdc20/Fizzy  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0005737  C:cytoplasm  
GO:0010997  F:anaphase-promoting complex binding  
GO:0030332  F:cyclin binding  
GO:1990757  F:ubiquitin ligase activator activity  
GO:1902426  P:deactivation of mitotic spindle assembly checkpoint  
GO:0010697  P:negative regulation of mitotic spindle pole body separation  
GO:1905786  P:positive regulation of anaphase-promoting complex-dependent catabolic process  
GO:0120151  P:positive regulation of mitotic actomyosin contractile ring disassembly  
Pfam View protein in Pfam  
PF12894  ANAPC4_WD40  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MILLPKKTPQKTPSSRRRNSMCGDRFIPNYSSGDKETQYNLAGPITPSKGKRRLPPSECDAIKEEQNKIYDSVVKLELLGQDIYENPLDKINKHRTSVYSFKTPKKRTYQMMDSDSPSQHKYSLTPVSQVSQSLLLTPRKATRHISKTPYKVLDAPELQDDFYLNLVDWSSTNQLSVGLGSCVYLWSACNSRVTRLCDLGPFDSVTSVNWMQKGTHLAVGTNRGLVQLWDIQRGCKIRQFAGHQARVGSLAWNGDILTSGSRDRQILNRDIRISSDYTKKYLVHKQEVCGLKWNYEENQLASGGNDNKLIIWDKASTTPLYRFEDHVAAVKAVSWSPHQHGLLASGGGTADRKIMFWNTLNGQLIQGIDTGSQVCNLSWSKTTNELVSTHGYSQNQIIIWKYPSMHQIATLIGHTYRVLYLAMSPDGQNIVTGAGDETLRFWNVFNKSKSKETQNGALSSFGHIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.85
4 0.85
5 0.82
6 0.8
7 0.8
8 0.76
9 0.72
10 0.69
11 0.64
12 0.59
13 0.55
14 0.49
15 0.41
16 0.37
17 0.33
18 0.32
19 0.31
20 0.32
21 0.29
22 0.3
23 0.3
24 0.29
25 0.28
26 0.26
27 0.24
28 0.21
29 0.21
30 0.19
31 0.22
32 0.24
33 0.28
34 0.31
35 0.39
36 0.47
37 0.52
38 0.6
39 0.64
40 0.71
41 0.7
42 0.73
43 0.71
44 0.71
45 0.66
46 0.6
47 0.54
48 0.46
49 0.47
50 0.44
51 0.41
52 0.36
53 0.38
54 0.35
55 0.33
56 0.32
57 0.31
58 0.27
59 0.28
60 0.24
61 0.22
62 0.21
63 0.21
64 0.2
65 0.17
66 0.16
67 0.12
68 0.11
69 0.11
70 0.13
71 0.13
72 0.13
73 0.11
74 0.16
75 0.18
76 0.19
77 0.28
78 0.37
79 0.41
80 0.42
81 0.46
82 0.45
83 0.51
84 0.58
85 0.53
86 0.53
87 0.54
88 0.61
89 0.67
90 0.69
91 0.7
92 0.71
93 0.73
94 0.71
95 0.73
96 0.73
97 0.7
98 0.72
99 0.66
100 0.59
101 0.56
102 0.5
103 0.44
104 0.37
105 0.29
106 0.24
107 0.22
108 0.2
109 0.22
110 0.28
111 0.26
112 0.28
113 0.28
114 0.28
115 0.28
116 0.27
117 0.22
118 0.16
119 0.15
120 0.14
121 0.19
122 0.19
123 0.19
124 0.21
125 0.26
126 0.26
127 0.3
128 0.34
129 0.38
130 0.44
131 0.51
132 0.57
133 0.59
134 0.62
135 0.66
136 0.62
137 0.55
138 0.5
139 0.45
140 0.43
141 0.36
142 0.32
143 0.28
144 0.26
145 0.24
146 0.2
147 0.18
148 0.11
149 0.1
150 0.09
151 0.06
152 0.05
153 0.06
154 0.06
155 0.05
156 0.07
157 0.09
158 0.09
159 0.09
160 0.09
161 0.09
162 0.09
163 0.09
164 0.07
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.04
173 0.06
174 0.09
175 0.1
176 0.16
177 0.16
178 0.2
179 0.25
180 0.29
181 0.3
182 0.29
183 0.29
184 0.25
185 0.27
186 0.24
187 0.2
188 0.16
189 0.13
190 0.12
191 0.11
192 0.09
193 0.11
194 0.12
195 0.12
196 0.12
197 0.13
198 0.12
199 0.14
200 0.17
201 0.13
202 0.14
203 0.13
204 0.13
205 0.14
206 0.18
207 0.16
208 0.14
209 0.12
210 0.1
211 0.1
212 0.09
213 0.09
214 0.1
215 0.11
216 0.15
217 0.15
218 0.15
219 0.18
220 0.21
221 0.2
222 0.19
223 0.2
224 0.17
225 0.23
226 0.27
227 0.33
228 0.4
229 0.41
230 0.38
231 0.37
232 0.35
233 0.31
234 0.27
235 0.18
236 0.1
237 0.08
238 0.07
239 0.07
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.06
247 0.07
248 0.09
249 0.09
250 0.1
251 0.15
252 0.19
253 0.26
254 0.3
255 0.32
256 0.33
257 0.33
258 0.33
259 0.3
260 0.27
261 0.23
262 0.27
263 0.25
264 0.25
265 0.27
266 0.28
267 0.32
268 0.37
269 0.41
270 0.42
271 0.43
272 0.43
273 0.48
274 0.49
275 0.44
276 0.45
277 0.38
278 0.31
279 0.3
280 0.31
281 0.25
282 0.27
283 0.27
284 0.19
285 0.2
286 0.18
287 0.16
288 0.14
289 0.17
290 0.14
291 0.14
292 0.13
293 0.12
294 0.11
295 0.13
296 0.15
297 0.11
298 0.11
299 0.11
300 0.12
301 0.15
302 0.17
303 0.16
304 0.16
305 0.2
306 0.23
307 0.27
308 0.27
309 0.26
310 0.28
311 0.28
312 0.26
313 0.27
314 0.23
315 0.18
316 0.17
317 0.16
318 0.14
319 0.12
320 0.13
321 0.11
322 0.14
323 0.17
324 0.23
325 0.22
326 0.22
327 0.22
328 0.23
329 0.21
330 0.18
331 0.14
332 0.09
333 0.09
334 0.08
335 0.08
336 0.06
337 0.07
338 0.08
339 0.08
340 0.1
341 0.12
342 0.15
343 0.16
344 0.21
345 0.2
346 0.25
347 0.27
348 0.25
349 0.23
350 0.21
351 0.19
352 0.15
353 0.13
354 0.09
355 0.07
356 0.08
357 0.08
358 0.07
359 0.09
360 0.09
361 0.08
362 0.12
363 0.13
364 0.15
365 0.17
366 0.19
367 0.21
368 0.26
369 0.28
370 0.25
371 0.27
372 0.25
373 0.25
374 0.27
375 0.27
376 0.24
377 0.27
378 0.25
379 0.24
380 0.25
381 0.25
382 0.21
383 0.2
384 0.19
385 0.19
386 0.2
387 0.22
388 0.21
389 0.21
390 0.25
391 0.28
392 0.26
393 0.24
394 0.23
395 0.22
396 0.22
397 0.2
398 0.17
399 0.13
400 0.14
401 0.12
402 0.12
403 0.11
404 0.1
405 0.1
406 0.08
407 0.1
408 0.13
409 0.14
410 0.14
411 0.15
412 0.15
413 0.16
414 0.15
415 0.13
416 0.1
417 0.09
418 0.08
419 0.08
420 0.07
421 0.07
422 0.08
423 0.08
424 0.09
425 0.11
426 0.13
427 0.13
428 0.13
429 0.19
430 0.27
431 0.35
432 0.4
433 0.46
434 0.5
435 0.58
436 0.64
437 0.66
438 0.67
439 0.64
440 0.67
441 0.65
442 0.63
443 0.56
444 0.51
445 0.43