Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VDJ0

Protein Details
Accession A0A1Y1VDJ0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VTPINKTKIVKKHTTKFFRHQSDRFKRVDHydrophilic
NLS Segment(s)
PositionSequence
34-38RKPKG
44-46RRR
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPINKTKIVKKHTTKFFRHQSDRFKRVDASWRKPKGIDGVVRRRFRGTIRMPKIGYGSNSKTRDLLPNGFKKFVVSNVKDLELLLMHNRTYAAEIAHNVSSKKRIEIVERAKQLNVKVTNAQARVRTQDNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.81
4 0.82
5 0.84
6 0.84
7 0.83
8 0.81
9 0.81
10 0.82
11 0.82
12 0.74
13 0.66
14 0.58
15 0.54
16 0.56
17 0.55
18 0.54
19 0.58
20 0.6
21 0.59
22 0.57
23 0.56
24 0.52
25 0.49
26 0.47
27 0.46
28 0.51
29 0.58
30 0.6
31 0.58
32 0.53
33 0.48
34 0.43
35 0.43
36 0.41
37 0.43
38 0.47
39 0.52
40 0.5
41 0.49
42 0.49
43 0.42
44 0.34
45 0.29
46 0.28
47 0.31
48 0.33
49 0.32
50 0.31
51 0.3
52 0.33
53 0.3
54 0.31
55 0.29
56 0.35
57 0.36
58 0.36
59 0.35
60 0.31
61 0.28
62 0.3
63 0.32
64 0.26
65 0.28
66 0.29
67 0.3
68 0.28
69 0.28
70 0.21
71 0.13
72 0.12
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.09
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.16
89 0.21
90 0.21
91 0.22
92 0.24
93 0.25
94 0.29
95 0.39
96 0.46
97 0.5
98 0.54
99 0.54
100 0.51
101 0.52
102 0.48
103 0.47
104 0.41
105 0.35
106 0.34
107 0.38
108 0.43
109 0.44
110 0.46
111 0.42
112 0.42
113 0.44