Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UCG8

Protein Details
Accession A0A1Y1UCG8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
180-200LDKNTLPEKKQRARKTCCACIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, E.R. 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019388  FIT  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0106399  F:acyl-coenzyme A diphosphatase activity  
GO:0019915  P:lipid storage  
Pfam View protein in Pfam  
PF10261  Scs3p  
Amino Acid Sequences MVKTLPPLNPIVIISFYFILVLVGSILRKYYFEEISENTYGTYTKKKSVINQYFAKLGWAWTTLVIFIFYLFSGKTKKSKIYSLIRYIIASLYWFILCKWAFGPGIFNRIQLQYGKCEVSNKNGEENTFVSATSISCHRVHKGHWIGFDVSGHVFLLVHSSLFLLEEIWPILRKQASYLLDKNTLPEKKQRARKTCCACILCLIIVFLWFYTLCITTTHYHHFREKIFGFLFPALYWFIGYQFFFPRYLPVETKEIVKKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.12
5 0.11
6 0.09
7 0.07
8 0.07
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.08
15 0.08
16 0.12
17 0.16
18 0.17
19 0.18
20 0.22
21 0.23
22 0.29
23 0.29
24 0.26
25 0.21
26 0.2
27 0.19
28 0.18
29 0.24
30 0.21
31 0.26
32 0.31
33 0.35
34 0.43
35 0.53
36 0.6
37 0.59
38 0.61
39 0.58
40 0.54
41 0.51
42 0.44
43 0.33
44 0.25
45 0.19
46 0.15
47 0.13
48 0.12
49 0.12
50 0.1
51 0.1
52 0.09
53 0.08
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.08
60 0.1
61 0.13
62 0.19
63 0.22
64 0.28
65 0.31
66 0.36
67 0.43
68 0.5
69 0.55
70 0.56
71 0.56
72 0.51
73 0.47
74 0.42
75 0.34
76 0.24
77 0.17
78 0.1
79 0.08
80 0.07
81 0.07
82 0.06
83 0.11
84 0.11
85 0.12
86 0.11
87 0.13
88 0.14
89 0.13
90 0.19
91 0.14
92 0.2
93 0.19
94 0.2
95 0.18
96 0.18
97 0.2
98 0.17
99 0.17
100 0.15
101 0.17
102 0.17
103 0.16
104 0.2
105 0.2
106 0.24
107 0.28
108 0.26
109 0.28
110 0.28
111 0.27
112 0.25
113 0.25
114 0.2
115 0.15
116 0.13
117 0.09
118 0.09
119 0.09
120 0.07
121 0.08
122 0.09
123 0.11
124 0.12
125 0.14
126 0.15
127 0.16
128 0.25
129 0.31
130 0.31
131 0.3
132 0.31
133 0.3
134 0.29
135 0.28
136 0.2
137 0.13
138 0.11
139 0.09
140 0.06
141 0.05
142 0.05
143 0.07
144 0.06
145 0.05
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.07
157 0.07
158 0.1
159 0.1
160 0.1
161 0.11
162 0.18
163 0.21
164 0.26
165 0.3
166 0.3
167 0.33
168 0.33
169 0.34
170 0.35
171 0.34
172 0.31
173 0.36
174 0.41
175 0.46
176 0.56
177 0.64
178 0.66
179 0.72
180 0.8
181 0.81
182 0.79
183 0.79
184 0.72
185 0.62
186 0.56
187 0.49
188 0.4
189 0.31
190 0.23
191 0.14
192 0.12
193 0.12
194 0.08
195 0.07
196 0.06
197 0.06
198 0.07
199 0.08
200 0.08
201 0.09
202 0.13
203 0.15
204 0.19
205 0.27
206 0.3
207 0.33
208 0.38
209 0.42
210 0.41
211 0.47
212 0.44
213 0.43
214 0.4
215 0.37
216 0.34
217 0.31
218 0.29
219 0.2
220 0.21
221 0.15
222 0.14
223 0.14
224 0.1
225 0.1
226 0.13
227 0.13
228 0.14
229 0.17
230 0.19
231 0.19
232 0.19
233 0.22
234 0.24
235 0.29
236 0.29
237 0.29
238 0.32
239 0.33
240 0.4
241 0.42