Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V7P2

Protein Details
Accession A0A1Y1V7P2   
Localization Confidence High
Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-68QYIVREAKRAKKPKKITYMPTPNPNAQSRPKPNKKKEVKSAGFHydrophilic
86-115EGNRATKEFKPERKRLGKKKSVKSFKSKSKBasic
NLS Segment(s)
PositionSequence
32-42AKRAKKPKKIT
47-65PNPNAQSRPKPNKKKEVKS
78-115TKNKSAAKEGNRATKEFKPERKRLGKKKSVKSFKSKSK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences KDLNRTKKRRLEALSEADREAIKEQQYIVREAKRAKKPKKITYMPTPNPNAQSRPKPNKKKEVKSAGFETEIKSTSETKNKSAAKEGNRATKEFKPERKRLGKKKSVKSFKSKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.63
3 0.56
4 0.49
5 0.43
6 0.36
7 0.29
8 0.23
9 0.17
10 0.16
11 0.17
12 0.2
13 0.22
14 0.24
15 0.27
16 0.27
17 0.3
18 0.35
19 0.43
20 0.49
21 0.58
22 0.62
23 0.68
24 0.74
25 0.79
26 0.83
27 0.81
28 0.78
29 0.78
30 0.81
31 0.76
32 0.74
33 0.68
34 0.6
35 0.57
36 0.52
37 0.46
38 0.4
39 0.44
40 0.47
41 0.54
42 0.62
43 0.68
44 0.73
45 0.79
46 0.83
47 0.82
48 0.82
49 0.82
50 0.76
51 0.7
52 0.67
53 0.59
54 0.51
55 0.43
56 0.35
57 0.27
58 0.23
59 0.19
60 0.17
61 0.17
62 0.19
63 0.26
64 0.27
65 0.27
66 0.35
67 0.37
68 0.37
69 0.42
70 0.45
71 0.43
72 0.49
73 0.51
74 0.53
75 0.52
76 0.52
77 0.5
78 0.48
79 0.52
80 0.52
81 0.58
82 0.58
83 0.64
84 0.73
85 0.79
86 0.85
87 0.86
88 0.88
89 0.88
90 0.89
91 0.91
92 0.92
93 0.92
94 0.89
95 0.89