Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V706

Protein Details
Accession A0A1Y1V706    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-33SDCNNSAKLRCPTCKKKNIEGGFFCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, cyto_nucl 13.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR000994  Pept_M24  
IPR001714  Pept_M24_MAP  
IPR002467  Pept_M24A_MAP1  
IPR031615  Zfn-C6H2  
Gene Ontology GO:0022626  C:cytosolic ribosome  
GO:0070006  F:metalloaminopeptidase activity  
GO:0003729  F:mRNA binding  
GO:0008270  F:zinc ion binding  
GO:0010629  P:negative regulation of gene expression  
GO:0035551  P:protein initiator methionine removal involved in protein maturation  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
PF15801  zf-C6H2  
PROSITE View protein in PROSITE  
PS00680  MAP_1  
CDD cd01086  MetAP1  
Amino Acid Sequences MVEHTCEKSDCNNSAKLRCPTCKKKNIEGGFFCSQECFKAAWVEHKAVHNVVTPYNPFPNYHFTGTLRPIYPLSPKREVPAHIELPDYAETGYPTSEMQISGDKQIEVITGKELELCRRACEITREVLEEAGKIIRPGITTDEIDRVVHEETIKRDAYPSPLNYMNYPKSVCTSVNECICHGIPDNRKLEDGDIINIDVSCYYKGFHGDSNKTFLVGKVDANGKKLVNVTKESLKRAIEIVKPGVLYREIGNVIEKYVKSQGFSVVRTYCGHGVHRHFHCPPTVCHYAHNKTFGVMKPGHIFTIEPMVNEGSYKDTQWPDEWTAVTVDGKRSAQFEHTILVTETGCEILTAKDNNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.61
4 0.62
5 0.66
6 0.72
7 0.75
8 0.79
9 0.83
10 0.82
11 0.83
12 0.86
13 0.85
14 0.84
15 0.78
16 0.75
17 0.7
18 0.63
19 0.53
20 0.44
21 0.36
22 0.28
23 0.25
24 0.18
25 0.15
26 0.2
27 0.21
28 0.28
29 0.32
30 0.34
31 0.36
32 0.39
33 0.4
34 0.35
35 0.35
36 0.32
37 0.29
38 0.27
39 0.27
40 0.26
41 0.27
42 0.31
43 0.3
44 0.26
45 0.28
46 0.33
47 0.34
48 0.34
49 0.33
50 0.3
51 0.36
52 0.38
53 0.4
54 0.34
55 0.31
56 0.29
57 0.29
58 0.36
59 0.37
60 0.4
61 0.41
62 0.41
63 0.43
64 0.47
65 0.47
66 0.44
67 0.44
68 0.41
69 0.36
70 0.36
71 0.32
72 0.3
73 0.29
74 0.22
75 0.15
76 0.11
77 0.11
78 0.1
79 0.1
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.12
87 0.13
88 0.15
89 0.17
90 0.15
91 0.15
92 0.15
93 0.15
94 0.11
95 0.11
96 0.1
97 0.09
98 0.09
99 0.12
100 0.12
101 0.14
102 0.19
103 0.19
104 0.19
105 0.2
106 0.21
107 0.2
108 0.25
109 0.25
110 0.23
111 0.24
112 0.24
113 0.23
114 0.23
115 0.21
116 0.16
117 0.14
118 0.11
119 0.1
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.11
126 0.13
127 0.13
128 0.15
129 0.16
130 0.16
131 0.15
132 0.14
133 0.13
134 0.11
135 0.11
136 0.11
137 0.11
138 0.12
139 0.17
140 0.17
141 0.15
142 0.16
143 0.16
144 0.2
145 0.22
146 0.21
147 0.21
148 0.23
149 0.24
150 0.24
151 0.29
152 0.26
153 0.23
154 0.23
155 0.19
156 0.18
157 0.19
158 0.18
159 0.15
160 0.17
161 0.19
162 0.22
163 0.22
164 0.2
165 0.2
166 0.19
167 0.18
168 0.15
169 0.18
170 0.19
171 0.25
172 0.28
173 0.26
174 0.27
175 0.26
176 0.26
177 0.23
178 0.19
179 0.14
180 0.12
181 0.11
182 0.11
183 0.1
184 0.09
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.06
191 0.08
192 0.09
193 0.13
194 0.19
195 0.24
196 0.25
197 0.3
198 0.29
199 0.28
200 0.27
201 0.23
202 0.21
203 0.17
204 0.16
205 0.14
206 0.21
207 0.21
208 0.23
209 0.25
210 0.21
211 0.21
212 0.24
213 0.24
214 0.21
215 0.23
216 0.24
217 0.3
218 0.33
219 0.34
220 0.36
221 0.32
222 0.3
223 0.29
224 0.32
225 0.27
226 0.27
227 0.26
228 0.23
229 0.23
230 0.22
231 0.22
232 0.17
233 0.15
234 0.12
235 0.14
236 0.13
237 0.13
238 0.15
239 0.14
240 0.14
241 0.17
242 0.16
243 0.15
244 0.21
245 0.21
246 0.19
247 0.2
248 0.26
249 0.26
250 0.27
251 0.3
252 0.25
253 0.27
254 0.27
255 0.29
256 0.25
257 0.24
258 0.26
259 0.27
260 0.32
261 0.38
262 0.4
263 0.44
264 0.43
265 0.44
266 0.46
267 0.43
268 0.4
269 0.39
270 0.43
271 0.37
272 0.41
273 0.48
274 0.49
275 0.5
276 0.52
277 0.44
278 0.39
279 0.44
280 0.39
281 0.37
282 0.3
283 0.3
284 0.31
285 0.32
286 0.31
287 0.26
288 0.24
289 0.19
290 0.27
291 0.23
292 0.18
293 0.19
294 0.19
295 0.19
296 0.19
297 0.18
298 0.14
299 0.15
300 0.15
301 0.2
302 0.21
303 0.24
304 0.26
305 0.31
306 0.29
307 0.31
308 0.31
309 0.26
310 0.25
311 0.24
312 0.24
313 0.22
314 0.21
315 0.23
316 0.23
317 0.24
318 0.24
319 0.25
320 0.26
321 0.27
322 0.25
323 0.23
324 0.22
325 0.23
326 0.22
327 0.22
328 0.18
329 0.15
330 0.14
331 0.12
332 0.11
333 0.09
334 0.09
335 0.09
336 0.15