Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V3P5

Protein Details
Accession A0A1Y1V3P5   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MNQIQKGDKRTKKDRKNKFPKFFNDPKLHydrophilic
NLS Segment(s)
PositionSequence
9-19KRTKKDRKNKF
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MNQIQKGDKRTKKDRKNKFPKFFNDPKLAEQIIYNKRNELINKEKKEKKGLNLVHTDFFNDFEDDFDDETI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.92
4 0.94
5 0.93
6 0.91
7 0.88
8 0.87
9 0.84
10 0.8
11 0.76
12 0.67
13 0.59
14 0.55
15 0.47
16 0.38
17 0.3
18 0.32
19 0.32
20 0.33
21 0.31
22 0.26
23 0.27
24 0.3
25 0.3
26 0.29
27 0.31
28 0.38
29 0.44
30 0.53
31 0.57
32 0.59
33 0.68
34 0.65
35 0.6
36 0.61
37 0.61
38 0.59
39 0.61
40 0.59
41 0.52
42 0.47
43 0.44
44 0.34
45 0.3
46 0.25
47 0.18
48 0.16
49 0.14
50 0.17
51 0.16