Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1V842

Protein Details
Accession A0A1Y1V842    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-33NSTSCKKLKRLQFNINLINRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MLPYFILTPNNYVNSTSCKKLKRLQFNINLINRIKNEVNPNKKFFSIDTESFIQEILTEFGWSVFNNNGTVIKEQHFIIDETYDLRNNDYIPENKKKYLFGNSERKPFHEIIKILQNEIDNVDFIIGQGIHNDIKYLHDSGIDFTNFTFIDGDSFDPNGKAIIEISDLFSAYSLSSPKSLEYGLNYFKIKYKNLHNAGNDAHYTMIYFLNIINNYDFDSPRYQRLLELNVPSHVSPCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.36
4 0.39
5 0.41
6 0.47
7 0.54
8 0.62
9 0.65
10 0.7
11 0.74
12 0.76
13 0.79
14 0.82
15 0.79
16 0.75
17 0.65
18 0.61
19 0.51
20 0.47
21 0.4
22 0.36
23 0.42
24 0.46
25 0.55
26 0.56
27 0.6
28 0.57
29 0.57
30 0.53
31 0.44
32 0.42
33 0.39
34 0.33
35 0.34
36 0.33
37 0.32
38 0.31
39 0.29
40 0.21
41 0.14
42 0.13
43 0.09
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.1
53 0.1
54 0.11
55 0.12
56 0.13
57 0.15
58 0.15
59 0.15
60 0.16
61 0.16
62 0.16
63 0.16
64 0.14
65 0.13
66 0.11
67 0.1
68 0.1
69 0.12
70 0.12
71 0.11
72 0.12
73 0.12
74 0.12
75 0.14
76 0.15
77 0.19
78 0.23
79 0.32
80 0.34
81 0.37
82 0.38
83 0.38
84 0.37
85 0.41
86 0.41
87 0.4
88 0.48
89 0.49
90 0.56
91 0.54
92 0.53
93 0.49
94 0.44
95 0.39
96 0.34
97 0.3
98 0.25
99 0.33
100 0.31
101 0.26
102 0.27
103 0.23
104 0.17
105 0.18
106 0.15
107 0.07
108 0.07
109 0.07
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.07
122 0.09
123 0.1
124 0.09
125 0.09
126 0.1
127 0.11
128 0.14
129 0.13
130 0.11
131 0.1
132 0.12
133 0.11
134 0.11
135 0.1
136 0.06
137 0.07
138 0.08
139 0.1
140 0.08
141 0.09
142 0.09
143 0.08
144 0.09
145 0.08
146 0.07
147 0.06
148 0.05
149 0.06
150 0.07
151 0.07
152 0.09
153 0.09
154 0.09
155 0.08
156 0.08
157 0.08
158 0.06
159 0.07
160 0.07
161 0.07
162 0.09
163 0.09
164 0.1
165 0.11
166 0.11
167 0.11
168 0.14
169 0.19
170 0.21
171 0.24
172 0.24
173 0.24
174 0.28
175 0.32
176 0.31
177 0.32
178 0.38
179 0.45
180 0.5
181 0.56
182 0.53
183 0.53
184 0.51
185 0.49
186 0.41
187 0.31
188 0.25
189 0.18
190 0.16
191 0.13
192 0.12
193 0.08
194 0.08
195 0.08
196 0.13
197 0.14
198 0.15
199 0.15
200 0.15
201 0.17
202 0.2
203 0.2
204 0.17
205 0.25
206 0.26
207 0.3
208 0.33
209 0.31
210 0.32
211 0.37
212 0.41
213 0.39
214 0.43
215 0.4
216 0.39
217 0.41
218 0.37