FuNGI

A0A1Y1VLW9

Protein Details

Accession

A0A1Y1VLW9

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
429-456	QAHLYYRKKTKEIRRELRKANKNYDANR	Hydrophilic

NLS Segment(s)

Position	Sequence
437-443	KTKEIRR

Subcellular Location(s)

cyto 13.5, cyto_nucl 13.5, nucl 10.5

Family & Domain DBs

InterPro	View protein in InterPro IPR012341 6hp_glycosidase-like_sf IPR044674 EDEM1/2/3 IPR001382 Glyco_hydro_47 IPR036026 Seven-hairpin_glycosidases
Gene Ontology	GO:0044322 C:endoplasmic reticulum quality control compartment GO:0016020 C:membrane GO:0005509 F:calcium ion binding GO:0004571 F:mannosyl-oligosaccharide 1,2-alpha-mannosidase activity GO:0005975 P:carbohydrate metabolic process GO:1904380 P:endoplasmic reticulum mannose trimming GO:1904382 P:mannose trimming involved in glycoprotein ERAD pathway
Pfam	View protein in Pfam PF01532 Glyco_hydro_47

Amino Acid Sequences

MFHTTYDSYVKNAYPEDELKPISCTGMNTWGNFSLTLIDALDTFGVMNDVEGFEKALEKVKKIDFDIDINISVFETTIRVLGGLLSSHLMAKNFGDKITYHDELLTLANDLGQRLLPAFDTPTGMPFGSINLKKGVHPEETTVTCTATIGTCSIEFTWLSILTDNPIYEFVCRRAIHSLWSHRTNKGLIGAHIDVFQGTWTEAAFSISGGVDSFYEYLLKAWIGFSDEKEYGEMFLEMYELIHEYLRRDDGWYVLHIYANPYNGKPMIDIFQSLGAYWPGVKILAGELIESNEELHLLADYLKNRSFLPERMRVDNLKLKGYDFVNYPLRPEFVESLSVMYKATRDPKLLKVAFKQVDRIRKWCKTTCGYANVKNVFTVEIEDKMESFFLSETLKYLYLLFDPDNEYNKNYIFSTEAHPFPVVKSNKSQAHLYYRKKTKEIRRELRKANKNYDANRYFMITNKNKTCEIDHWECSPFFRYYASPKHNYNERYDYYKNYLSPNFKNQPNGRDLFVDFRKGICSYQHWVEASIMGLETDPRIFI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.28
3	0.29
4	0.31
5	0.32
6	0.29
7	0.3
8	0.29
9	0.25
10	0.23
11	0.22
12	0.2
13	0.28
14	0.3
15	0.29
16	0.32
17	0.32
18	0.31
19	0.29
20	0.26
21	0.18
22	0.16
23	0.16
24	0.13
25	0.1
26	0.09
27	0.1
28	0.09
29	0.07
30	0.06
31	0.05
32	0.06
33	0.05
34	0.05
35	0.06
36	0.07
37	0.07
38	0.08
39	0.08
40	0.08
41	0.1
42	0.11
43	0.18
44	0.2
45	0.21
46	0.28
47	0.31
48	0.36
49	0.36
50	0.41
51	0.35
52	0.36
53	0.38
54	0.34
55	0.3
56	0.26
57	0.24
58	0.18
59	0.16
60	0.13
61	0.09
62	0.07
63	0.06
64	0.06
65	0.06
66	0.06
67	0.06
68	0.07
69	0.07
70	0.06
71	0.07
72	0.07
73	0.07
74	0.09
75	0.1
76	0.1
77	0.11
78	0.12
79	0.17
80	0.17
81	0.17
82	0.17
83	0.16
84	0.21
85	0.28
86	0.28
87	0.22
88	0.22
89	0.22
90	0.21
91	0.22
92	0.16
93	0.1
94	0.08
95	0.1
96	0.1
97	0.1
98	0.09
99	0.08
100	0.08
101	0.08
102	0.09
103	0.07
104	0.08
105	0.1
106	0.1
107	0.12
108	0.12
109	0.13
110	0.14
111	0.13
112	0.13
113	0.11
114	0.13
115	0.19
116	0.2
117	0.2
118	0.22
119	0.23
120	0.24
121	0.29
122	0.31
123	0.27
124	0.27
125	0.28
126	0.29
127	0.3
128	0.32
129	0.27
130	0.23
131	0.19
132	0.17
133	0.15
134	0.11
135	0.1
136	0.07
137	0.08
138	0.07
139	0.09
140	0.09
141	0.09
142	0.09
143	0.08
144	0.1
145	0.09
146	0.09
147	0.09
148	0.09
149	0.09
150	0.11
151	0.1
152	0.09
153	0.1
154	0.1
155	0.11
156	0.13
157	0.13
158	0.2
159	0.2
160	0.21
161	0.25
162	0.25
163	0.28
164	0.33
165	0.4
166	0.39
167	0.47
168	0.48
169	0.45
170	0.47
171	0.43
172	0.37
173	0.34
174	0.3
175	0.22
176	0.24
177	0.24
178	0.22
179	0.21
180	0.2
181	0.13
182	0.11
183	0.11
184	0.06
185	0.05
186	0.05
187	0.04
188	0.05
189	0.05
190	0.06
191	0.06
192	0.05
193	0.06
194	0.05
195	0.06
196	0.05
197	0.05
198	0.04
199	0.05
200	0.05
201	0.05
202	0.05
203	0.05
204	0.05
205	0.06
206	0.06
207	0.05
208	0.05
209	0.05
210	0.08
211	0.09
212	0.09
213	0.13
214	0.14
215	0.14
216	0.14
217	0.14
218	0.11
219	0.11
220	0.11
221	0.06
222	0.05
223	0.05
224	0.05
225	0.05
226	0.04
227	0.04
228	0.04
229	0.05
230	0.05
231	0.06
232	0.08
233	0.09
234	0.09
235	0.1
236	0.1
237	0.1
238	0.11
239	0.11
240	0.12
241	0.12
242	0.12
243	0.11
244	0.13
245	0.13
246	0.14
247	0.14
248	0.12
249	0.13
250	0.13
251	0.13
252	0.11
253	0.1
254	0.1
255	0.09
256	0.09
257	0.08
258	0.1
259	0.09
260	0.09
261	0.09
262	0.07
263	0.06
264	0.06
265	0.06
266	0.04
267	0.04
268	0.04
269	0.03
270	0.04
271	0.05
272	0.05
273	0.05
274	0.05
275	0.06
276	0.06
277	0.06
278	0.06
279	0.04
280	0.04
281	0.04
282	0.04
283	0.03
284	0.04
285	0.05
286	0.07
287	0.08
288	0.11
289	0.12
290	0.13
291	0.13
292	0.16
293	0.18
294	0.21
295	0.27
296	0.33
297	0.35
298	0.37
299	0.4
300	0.37
301	0.4
302	0.41
303	0.36
304	0.31
305	0.28
306	0.25
307	0.26
308	0.25
309	0.22
310	0.17
311	0.21
312	0.24
313	0.24
314	0.25
315	0.22
316	0.22
317	0.2
318	0.21
319	0.18
320	0.13
321	0.14
322	0.13
323	0.14
324	0.14
325	0.14
326	0.11
327	0.1
328	0.09
329	0.11
330	0.17
331	0.17
332	0.2
333	0.23
334	0.29
335	0.38
336	0.4
337	0.41
338	0.39
339	0.46
340	0.47
341	0.44
342	0.47
343	0.42
344	0.49
345	0.49
346	0.53
347	0.52
348	0.54
349	0.6
350	0.58
351	0.6
352	0.55
353	0.59
354	0.57
355	0.58
356	0.57
357	0.57
358	0.59
359	0.55
360	0.51
361	0.44
362	0.38
363	0.29
364	0.24
365	0.2
366	0.14
367	0.12
368	0.13
369	0.13
370	0.13
371	0.12
372	0.12
373	0.09
374	0.08
375	0.06
376	0.06
377	0.08
378	0.08
379	0.08
380	0.1
381	0.11
382	0.1
383	0.11
384	0.1
385	0.1
386	0.12
387	0.11
388	0.11
389	0.15
390	0.17
391	0.21
392	0.21
393	0.22
394	0.22
395	0.22
396	0.22
397	0.18
398	0.17
399	0.15
400	0.15
401	0.19
402	0.22
403	0.22
404	0.22
405	0.22
406	0.22
407	0.21
408	0.29
409	0.27
410	0.25
411	0.3
412	0.36
413	0.41
414	0.44
415	0.45
416	0.41
417	0.49
418	0.56
419	0.59
420	0.61
421	0.64
422	0.66
423	0.7
424	0.74
425	0.74
426	0.75
427	0.78
428	0.79
429	0.81
430	0.85
431	0.89
432	0.91
433	0.9
434	0.87
435	0.85
436	0.84
437	0.81
438	0.77
439	0.77
440	0.69
441	0.61
442	0.54
443	0.48
444	0.39
445	0.36
446	0.41
447	0.37
448	0.44
449	0.47
450	0.5
451	0.49
452	0.51
453	0.51
454	0.46
455	0.48
456	0.46
457	0.43
458	0.43
459	0.45
460	0.43
461	0.4
462	0.38
463	0.31
464	0.24
465	0.23
466	0.24
467	0.28
468	0.38
469	0.44
470	0.46
471	0.49
472	0.56
473	0.62
474	0.62
475	0.62
476	0.6
477	0.56
478	0.57
479	0.56
480	0.55
481	0.53
482	0.55
483	0.5
484	0.48
485	0.52
486	0.52
487	0.55
488	0.59
489	0.61
490	0.59
491	0.67
492	0.66
493	0.65
494	0.66
495	0.61
496	0.53
497	0.49
498	0.47
499	0.45
500	0.43
501	0.41
502	0.34
503	0.33
504	0.34
505	0.32
506	0.32
507	0.28
508	0.3
509	0.3
510	0.34
511	0.39
512	0.37
513	0.37
514	0.36
515	0.32
516	0.28
517	0.22
518	0.17
519	0.11
520	0.11
521	0.1
522	0.1

A0A1Y1VLW9

3D AlphaFold-predicted Structure Viewer