A0A1Y1VGP6

UniProt ID: A0A1Y1VGP6   Organism: Piromyces finnis
Gene: BCR36DRAFT_581060   Protein: Uncharacterized protein
Length: 82 AA

Protein Details

• Accession: A0A1Y1VGP6
• Localization Confidence: Low
• Confidence Score: 8.1
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  34-57	RCKECGYRIMYKKRTKRMVQFEAR	Hydrophilic

• Subcellular Location(s): cyto_nucl 15, nucl 12, cyto 12
• Family & Domain DBs:
  • InterPro:
    • IPR006591 RNAP_P/RPABC4
    • IPR039747 RPABC4
    • IPR029040 RPABC4/Spt4
  • Gene Ontology:
    • GO:0005736 C:RNA polymerase I complex
    • GO:0005665 C:RNA polymerase II, core complex
    • GO:0005666 C:RNA polymerase III complex
    • GO:0003677 F:DNA binding
    • GO:0001054 F:RNA polymerase I activity
    • GO:0001055 F:RNA polymerase II activity
    • GO:0001056 F:RNA polymerase III activity
    • GO:0003968 F:RNA-dependent RNA polymerase activity
    • GO:0008270 F:zinc ion binding
    • GO:0006363 P:termination of RNA polymerase I transcription
    • GO:0006386 P:termination of RNA polymerase III transcription
    • GO:0006362 P:transcription elongation by RNA polymerase I
    • GO:0006368 P:transcription elongation by RNA polymerase II
    • GO:0006361 P:transcription initiation at RNA polymerase I promoter
    • GO:0006367 P:transcription initiation at RNA polymerase II promoter
    • GO:0006384 P:transcription initiation at RNA polymerase III promoter
    • GO:0042797 P:tRNA transcription by RNA polymerase III
  • Pfam:
    • PF03604 DNA_RNApol_7kD
• Amino Acid Sequences: MYGAPQAVQRPQQISYICGDCGVENDIRPKEPIRCKECGYRIMYKKRTKRMVQFEAR

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.29
2, 0.29
3, 0.26
4, 0.22
5, 0.19
6, 0.18
7, 0.13
8, 0.13
9, 0.14
10, 0.1
11, 0.09
12, 0.14
13, 0.15
14, 0.15
15, 0.16
16, 0.17
17, 0.22
18, 0.3
19, 0.38
20, 0.38
21, 0.41
22, 0.44
23, 0.51
24, 0.54
25, 0.54
26, 0.51
27, 0.52
28, 0.56
29, 0.63
30, 0.69
31, 0.7
32, 0.75
33, 0.78
34, 0.83
35, 0.82
36, 0.83
37, 0.83