Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UWD0

Protein Details
Accession A0A1Y1UWD0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-114IHKKQFNHWKYYRYNKNRSLKMSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038089  Med31_sf  
IPR008831  Mediator_Med31  
Gene Ontology GO:0070847  C:core mediator complex  
GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006281  P:DNA repair  
GO:0006311  P:meiotic gene conversion  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
Pfam View protein in Pfam  
PF05669  Med31  
Amino Acid Sequences MITKEDKNKERFQLELEFIQMLSNPLYLHWLAQEGYFNKPEFINYLEYLKYWKNEEYSKFIMFPYCLAILDLLQHKEFRDSLANNDFALNIHKKQFNHWKYYRYNKNRSLKMSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.35
4 0.27
5 0.24
6 0.23
7 0.19
8 0.13
9 0.1
10 0.1
11 0.08
12 0.08
13 0.11
14 0.1
15 0.1
16 0.09
17 0.1
18 0.1
19 0.1
20 0.15
21 0.13
22 0.17
23 0.19
24 0.19
25 0.18
26 0.18
27 0.18
28 0.15
29 0.16
30 0.16
31 0.14
32 0.15
33 0.14
34 0.14
35 0.17
36 0.16
37 0.16
38 0.14
39 0.15
40 0.16
41 0.2
42 0.23
43 0.26
44 0.28
45 0.27
46 0.26
47 0.24
48 0.22
49 0.18
50 0.16
51 0.12
52 0.1
53 0.09
54 0.08
55 0.08
56 0.07
57 0.1
58 0.12
59 0.11
60 0.11
61 0.12
62 0.12
63 0.14
64 0.15
65 0.14
66 0.18
67 0.17
68 0.22
69 0.26
70 0.27
71 0.25
72 0.25
73 0.23
74 0.18
75 0.22
76 0.2
77 0.18
78 0.23
79 0.27
80 0.27
81 0.36
82 0.47
83 0.48
84 0.54
85 0.57
86 0.6
87 0.65
88 0.75
89 0.78
90 0.77
91 0.81
92 0.81
93 0.86
94 0.86