Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VMY0

Protein Details
Accession A0A1Y1VMY0   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MTNKKVARATPKKPQASKPKRKEKPLFVKLYLHydrophilic
NLS Segment(s)
PositionSequence
5-24KVARATPKKPQASKPKRKEK
221-230KHVLGGKKKK
Subcellular Location(s) mito 12.5, mito_nucl 11.833, nucl 10, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007482  Tyr_Pase-like_PTPLA  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0000324  C:fungal-type vacuole  
GO:0018812  F:3-hydroxyacyl-CoA dehydratase activity  
GO:0030497  P:fatty acid elongation  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0007034  P:vacuolar transport  
Pfam View protein in Pfam  
PF04387  PTPLA  
Amino Acid Sequences MTNKKVARATPKKPQASKPKRKEKPLFVKLYLFVYNMLSFAGWSYVLLLLIKTLIETNGDYSKVYDNIRNELTIVQACASLEILHSLIGFVPSPVFTTTCQVFSRLFVSYFVLYFTNDSKTYQSPFLSLMVIAWCVTEVIRYLYYALNIFKIQVKILTWIRYTFFYVLYPVGASSECVLIYTAIPAIAKINQYLPYVCYMTLLFYIPLFPMLYMHMIKQRKHVLGGKKKKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.84
4 0.87
5 0.87
6 0.88
7 0.88
8 0.92
9 0.92
10 0.92
11 0.92
12 0.9
13 0.88
14 0.8
15 0.76
16 0.66
17 0.61
18 0.51
19 0.4
20 0.31
21 0.25
22 0.22
23 0.17
24 0.15
25 0.11
26 0.09
27 0.08
28 0.08
29 0.06
30 0.05
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.07
44 0.1
45 0.12
46 0.12
47 0.12
48 0.13
49 0.15
50 0.17
51 0.19
52 0.2
53 0.2
54 0.24
55 0.25
56 0.23
57 0.22
58 0.19
59 0.19
60 0.15
61 0.14
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.06
68 0.05
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.06
81 0.06
82 0.07
83 0.07
84 0.1
85 0.11
86 0.14
87 0.14
88 0.15
89 0.14
90 0.14
91 0.16
92 0.14
93 0.13
94 0.11
95 0.12
96 0.11
97 0.11
98 0.1
99 0.09
100 0.08
101 0.09
102 0.09
103 0.1
104 0.1
105 0.11
106 0.12
107 0.13
108 0.15
109 0.17
110 0.16
111 0.14
112 0.14
113 0.14
114 0.12
115 0.11
116 0.09
117 0.07
118 0.07
119 0.06
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.06
127 0.06
128 0.07
129 0.08
130 0.08
131 0.09
132 0.11
133 0.1
134 0.1
135 0.1
136 0.11
137 0.13
138 0.13
139 0.13
140 0.13
141 0.13
142 0.17
143 0.2
144 0.23
145 0.2
146 0.21
147 0.22
148 0.23
149 0.24
150 0.2
151 0.17
152 0.14
153 0.15
154 0.14
155 0.12
156 0.11
157 0.08
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.06
173 0.08
174 0.1
175 0.11
176 0.11
177 0.14
178 0.16
179 0.18
180 0.19
181 0.19
182 0.2
183 0.2
184 0.19
185 0.18
186 0.14
187 0.14
188 0.15
189 0.15
190 0.11
191 0.1
192 0.11
193 0.1
194 0.11
195 0.1
196 0.09
197 0.08
198 0.1
199 0.14
200 0.14
201 0.16
202 0.23
203 0.28
204 0.3
205 0.38
206 0.45
207 0.44
208 0.5
209 0.55
210 0.58
211 0.63
212 0.73