Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V5C7

Protein Details
Accession A0A1Y1V5C7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-36NKGLIRCVRVRSKKQQMEKSKKVAIHydrophilic
104-134DPFSEKNKNIKVRKINKRKYNRKNEYITNMLHydrophilic
NLS Segment(s)
PositionSequence
113-123IKVRKINKRKY
Subcellular Location(s) nucl 18.5, mito_nucl 14, mito 8.5
Family & Domain DBs
Amino Acid Sequences MLSYPINNYNNNKGLIRCVRVRSKKQQMEKSKKVAILALQNNNKIHSVTPLRNNKKNEGEEYNSNDEIYTQFKIEKSKPKSWLELWQKPLNGEIVIEEQQNNMDPFSEKNKNIKVRKINKRKYNRKNEYITNMLIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.42
5 0.45
6 0.53
7 0.6
8 0.68
9 0.7
10 0.75
11 0.78
12 0.82
13 0.85
14 0.86
15 0.87
16 0.86
17 0.83
18 0.77
19 0.7
20 0.61
21 0.53
22 0.45
23 0.43
24 0.42
25 0.42
26 0.41
27 0.43
28 0.43
29 0.42
30 0.39
31 0.3
32 0.24
33 0.22
34 0.24
35 0.25
36 0.33
37 0.43
38 0.49
39 0.55
40 0.58
41 0.58
42 0.6
43 0.58
44 0.54
45 0.48
46 0.46
47 0.43
48 0.45
49 0.43
50 0.35
51 0.32
52 0.27
53 0.22
54 0.18
55 0.16
56 0.11
57 0.08
58 0.09
59 0.1
60 0.15
61 0.19
62 0.28
63 0.33
64 0.4
65 0.47
66 0.49
67 0.52
68 0.5
69 0.56
70 0.56
71 0.56
72 0.55
73 0.52
74 0.49
75 0.45
76 0.44
77 0.35
78 0.25
79 0.18
80 0.13
81 0.12
82 0.13
83 0.13
84 0.12
85 0.11
86 0.11
87 0.14
88 0.13
89 0.09
90 0.09
91 0.1
92 0.12
93 0.2
94 0.27
95 0.27
96 0.35
97 0.43
98 0.52
99 0.57
100 0.64
101 0.67
102 0.71
103 0.79
104 0.83
105 0.85
106 0.86
107 0.91
108 0.93
109 0.93
110 0.94
111 0.93
112 0.91
113 0.89
114 0.87
115 0.84
116 0.79