Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1V3I9

Protein Details
Accession A0A1Y1V3I9    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTLPINKIHRRNTKKQVERNFLLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR010926  Myosin_TH1  
Gene Ontology GO:0016459  C:myosin complex  
GO:0005524  F:ATP binding  
GO:0003774  F:cytoskeletal motor activity  
Pfam View protein in Pfam  
PF06017  Myosin_TH1  
PROSITE View protein in PROSITE  
PS51757  TH1  
Amino Acid Sequences MTLPINKIHRRNTKKQVERNFLLTNNSIYILNSDNSKIKDIINLSDISTISTSPLNDNIMILHVKNSSKGDLMLSTEERNSTKVISVISYIWMLARKRGIQIPINVSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.88
4 0.86
5 0.8
6 0.77
7 0.7
8 0.6
9 0.54
10 0.46
11 0.37
12 0.28
13 0.26
14 0.19
15 0.15
16 0.15
17 0.13
18 0.12
19 0.12
20 0.13
21 0.15
22 0.16
23 0.18
24 0.18
25 0.16
26 0.19
27 0.19
28 0.19
29 0.17
30 0.17
31 0.15
32 0.16
33 0.15
34 0.12
35 0.11
36 0.1
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.08
47 0.08
48 0.07
49 0.08
50 0.09
51 0.09
52 0.11
53 0.13
54 0.12
55 0.12
56 0.13
57 0.12
58 0.11
59 0.13
60 0.14
61 0.14
62 0.14
63 0.14
64 0.16
65 0.15
66 0.16
67 0.15
68 0.13
69 0.12
70 0.13
71 0.13
72 0.12
73 0.13
74 0.12
75 0.13
76 0.13
77 0.11
78 0.11
79 0.16
80 0.15
81 0.18
82 0.23
83 0.23
84 0.27
85 0.32
86 0.37
87 0.38
88 0.44
89 0.47