Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UXG0

Protein Details
Accession A0A1Y1UXG0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
210-235CEDVVFKKRLYRKKPRKAFAPDTGVYHydrophilic
NLS Segment(s)
PositionSequence
217-226KRLYRKKPRK
Subcellular Location(s) E.R. 9, golg 4, nucl 3, mito 3, mito_nucl 3, extr 2, cyto_nucl 2, pero 2, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF00535  Glycos_transf_2  
CDD cd00761  Glyco_tranf_GTA_type  
Amino Acid Sequences MKVNLIVLIFTTIILSFHFRLNYAYPEYMNIRNDNDDDFEEFNIGKRGYNVKVSIVIPAYNLEDKIGRCIESALNQTLKDIEIIVIDDKSTDATKSVIQEYERMDDRIKAIYSKTNNGAGYSRNLGIEKAEGKFIGFIDGDDYVDPGWFEHLYNNKKRKDIVHGVRVIHNFSETFTKSEEKPYGCIIPSIIRKRFLMRRNIRFPTFKENCEDVVFKKRLYRKKPRKAFAPDTGVYYHYDLREGSLSNYTNPNIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.12
4 0.15
5 0.16
6 0.16
7 0.19
8 0.22
9 0.25
10 0.26
11 0.26
12 0.23
13 0.26
14 0.3
15 0.32
16 0.33
17 0.31
18 0.29
19 0.3
20 0.31
21 0.29
22 0.27
23 0.23
24 0.23
25 0.21
26 0.19
27 0.17
28 0.16
29 0.16
30 0.18
31 0.17
32 0.15
33 0.17
34 0.21
35 0.23
36 0.28
37 0.27
38 0.24
39 0.28
40 0.28
41 0.28
42 0.24
43 0.22
44 0.17
45 0.17
46 0.18
47 0.15
48 0.15
49 0.12
50 0.14
51 0.14
52 0.18
53 0.18
54 0.16
55 0.15
56 0.17
57 0.17
58 0.18
59 0.22
60 0.21
61 0.21
62 0.21
63 0.21
64 0.2
65 0.19
66 0.15
67 0.11
68 0.08
69 0.06
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.06
79 0.06
80 0.07
81 0.09
82 0.11
83 0.13
84 0.14
85 0.14
86 0.16
87 0.18
88 0.2
89 0.2
90 0.19
91 0.18
92 0.17
93 0.18
94 0.18
95 0.17
96 0.14
97 0.14
98 0.18
99 0.2
100 0.22
101 0.23
102 0.24
103 0.24
104 0.24
105 0.24
106 0.19
107 0.19
108 0.18
109 0.16
110 0.13
111 0.13
112 0.12
113 0.11
114 0.11
115 0.11
116 0.09
117 0.09
118 0.09
119 0.08
120 0.09
121 0.09
122 0.09
123 0.07
124 0.06
125 0.07
126 0.07
127 0.08
128 0.07
129 0.07
130 0.05
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.05
137 0.09
138 0.17
139 0.23
140 0.32
141 0.4
142 0.42
143 0.44
144 0.46
145 0.46
146 0.47
147 0.51
148 0.51
149 0.51
150 0.53
151 0.53
152 0.55
153 0.53
154 0.45
155 0.35
156 0.27
157 0.19
158 0.15
159 0.19
160 0.15
161 0.15
162 0.16
163 0.19
164 0.18
165 0.25
166 0.29
167 0.25
168 0.26
169 0.27
170 0.29
171 0.26
172 0.26
173 0.21
174 0.23
175 0.3
176 0.36
177 0.37
178 0.37
179 0.37
180 0.44
181 0.51
182 0.51
183 0.54
184 0.56
185 0.63
186 0.69
187 0.75
188 0.73
189 0.7
190 0.66
191 0.66
192 0.61
193 0.53
194 0.5
195 0.46
196 0.43
197 0.42
198 0.4
199 0.32
200 0.37
201 0.37
202 0.32
203 0.37
204 0.44
205 0.5
206 0.58
207 0.66
208 0.68
209 0.77
210 0.86
211 0.87
212 0.88
213 0.89
214 0.87
215 0.85
216 0.83
217 0.72
218 0.65
219 0.59
220 0.5
221 0.42
222 0.36
223 0.3
224 0.22
225 0.22
226 0.19
227 0.2
228 0.21
229 0.2
230 0.2
231 0.23
232 0.24
233 0.25
234 0.3