Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VCH2

Protein Details
Accession A0A1Y1VCH2   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-47LKFVSKRKSKFYDKIKNDGFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6.5, cyto_nucl 6, mito 5, nucl 4.5, extr 4, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000195  Rab-GAP-TBC_dom  
IPR035969  Rab-GAP_TBC_sf  
Gene Ontology GO:1990334  C:Bfa1-Bub2 complex  
GO:0071957  C:old mitotic spindle pole body  
GO:0005096  F:GTPase activator activity  
GO:1902543  P:negative regulation of protein localization to mitotic spindle pole body  
GO:0031030  P:negative regulation of septation initiation signaling  
GO:0043547  P:positive regulation of GTPase activity  
Pfam View protein in Pfam  
PF00566  RabGAP-TBC  
PROSITE View protein in PROSITE  
PS50086  TBC_RABGAP  
Amino Acid Sequences MNSYTASLRGKIWKILLGVYRVSASEYLKFVSKRKSKFYDKIKNDGFRTLRTDEKFKQKVTDNMIVRLLNAFVWSKEKEKIVSDVNCNFTYVQGMNVIAAPFLYVLPEMEAFYAFSTFIQYYCPLYVHSSLIGAHAGAKLLDICLEIIDPELYNHLTKNQLTAEIYAFSSILSFCACTPPLQELLCLWDFLFAFGVHLNIIFVIAQMIIIREELLNEKNPYHKLRNFPNLNSKLIIAVSISLIPKIPKDIYTKIVNHTHDYKTVEELLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.32
5 0.3
6 0.27
7 0.25
8 0.21
9 0.22
10 0.19
11 0.17
12 0.17
13 0.18
14 0.18
15 0.23
16 0.25
17 0.28
18 0.36
19 0.43
20 0.45
21 0.53
22 0.61
23 0.65
24 0.72
25 0.78
26 0.79
27 0.77
28 0.81
29 0.8
30 0.79
31 0.71
32 0.71
33 0.63
34 0.55
35 0.55
36 0.48
37 0.47
38 0.43
39 0.48
40 0.46
41 0.54
42 0.56
43 0.52
44 0.54
45 0.53
46 0.56
47 0.56
48 0.58
49 0.49
50 0.47
51 0.49
52 0.42
53 0.37
54 0.3
55 0.23
56 0.14
57 0.14
58 0.11
59 0.09
60 0.13
61 0.14
62 0.16
63 0.19
64 0.21
65 0.21
66 0.22
67 0.25
68 0.29
69 0.31
70 0.34
71 0.35
72 0.38
73 0.36
74 0.35
75 0.31
76 0.24
77 0.23
78 0.17
79 0.13
80 0.1
81 0.09
82 0.09
83 0.1
84 0.09
85 0.07
86 0.06
87 0.05
88 0.05
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.08
108 0.09
109 0.09
110 0.1
111 0.09
112 0.11
113 0.12
114 0.11
115 0.1
116 0.09
117 0.09
118 0.09
119 0.08
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.06
140 0.07
141 0.07
142 0.08
143 0.11
144 0.11
145 0.13
146 0.12
147 0.13
148 0.14
149 0.15
150 0.14
151 0.12
152 0.12
153 0.1
154 0.09
155 0.07
156 0.07
157 0.06
158 0.05
159 0.04
160 0.05
161 0.05
162 0.08
163 0.09
164 0.09
165 0.1
166 0.12
167 0.15
168 0.14
169 0.15
170 0.12
171 0.16
172 0.16
173 0.15
174 0.13
175 0.13
176 0.12
177 0.12
178 0.14
179 0.08
180 0.09
181 0.09
182 0.09
183 0.06
184 0.06
185 0.06
186 0.04
187 0.05
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.09
201 0.12
202 0.16
203 0.17
204 0.19
205 0.24
206 0.29
207 0.35
208 0.4
209 0.43
210 0.46
211 0.54
212 0.63
213 0.64
214 0.65
215 0.7
216 0.65
217 0.63
218 0.56
219 0.47
220 0.38
221 0.32
222 0.26
223 0.15
224 0.12
225 0.1
226 0.12
227 0.12
228 0.11
229 0.12
230 0.13
231 0.13
232 0.18
233 0.18
234 0.2
235 0.26
236 0.3
237 0.34
238 0.41
239 0.44
240 0.46
241 0.52
242 0.5
243 0.5
244 0.51
245 0.49
246 0.46
247 0.46
248 0.41
249 0.38