Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UWM7

Protein Details
Accession A0A1Y1UWM7    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-72AYTSACKSRRYNKNVQKCLIKFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.833, mito_nucl 8.833, mito 8.5, cyto 8.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF00023  Ank  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MNTILNVINNKGETPLHWACKCYNYENDKTMIELLKLGTEVDKQDNDRNSAYTSACKSRRYNKNVQKCLIKFGVKIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.3
4 0.3
5 0.32
6 0.32
7 0.38
8 0.4
9 0.36
10 0.39
11 0.38
12 0.42
13 0.42
14 0.42
15 0.36
16 0.34
17 0.31
18 0.23
19 0.17
20 0.13
21 0.1
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.07
28 0.09
29 0.1
30 0.12
31 0.17
32 0.19
33 0.22
34 0.22
35 0.22
36 0.21
37 0.22
38 0.21
39 0.2
40 0.22
41 0.28
42 0.31
43 0.35
44 0.4
45 0.48
46 0.57
47 0.62
48 0.69
49 0.71
50 0.78
51 0.81
52 0.82
53 0.81
54 0.73
55 0.72
56 0.68
57 0.61