Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VMR1

Protein Details
Accession A0A1Y1VMR1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-123LVEKVQQSRKQIKEKKNRSKKFRGTKKAHydrophilic
NLS Segment(s)
PositionSequence
104-123RKQIKEKKNRSKKFRGTKKA
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences ADATCTIRTRKFMTNRLLQRKQMIVDIIHPNSANLSKSDLRDKLSKMYKADKENIFVFGFRTHYGGGKSTGYALIYDTIEAAKKFEPKYRLVRQGLVEKVQQSRKQIKEKKNRSKKFRGTKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.76
4 0.77
5 0.71
6 0.68
7 0.64
8 0.57
9 0.5
10 0.42
11 0.33
12 0.32
13 0.36
14 0.31
15 0.29
16 0.27
17 0.24
18 0.23
19 0.24
20 0.19
21 0.12
22 0.16
23 0.18
24 0.2
25 0.27
26 0.27
27 0.28
28 0.32
29 0.33
30 0.36
31 0.4
32 0.41
33 0.38
34 0.45
35 0.47
36 0.47
37 0.52
38 0.46
39 0.42
40 0.39
41 0.39
42 0.3
43 0.25
44 0.21
45 0.15
46 0.15
47 0.12
48 0.12
49 0.1
50 0.11
51 0.11
52 0.12
53 0.12
54 0.11
55 0.11
56 0.1
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.08
67 0.08
68 0.09
69 0.09
70 0.14
71 0.16
72 0.22
73 0.25
74 0.3
75 0.4
76 0.47
77 0.54
78 0.52
79 0.55
80 0.53
81 0.57
82 0.55
83 0.49
84 0.43
85 0.37
86 0.41
87 0.45
88 0.44
89 0.44
90 0.51
91 0.56
92 0.64
93 0.7
94 0.74
95 0.77
96 0.85
97 0.88
98 0.9
99 0.92
100 0.91
101 0.93
102 0.93
103 0.93