Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UCT3

Protein Details
Accession A0A1Y1UCT3    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-48IEQIKTFLTRRKYKNNSNKDQLKNFEHydrophilic
NLS Segment(s)
PositionSequence
109-112KHKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026171  FANCI  
IPR029314  FANCI_S4  
Gene Ontology GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF14678  FANCI_S4  
Amino Acid Sequences YSSILMTLYYNLNELLDEVEWSIEQIKTFLTRRKYKNNSNKDQLKNFEQKLYKKMKYVIKLKDYKLIDPEYVEMMNMVSSSLTQDLYEFIFYLQKLDIEIAALNEANKKHKRGGNYKQKTKIVRESKMIPNLIYMVEIYERYLIQLTKKTGVNINLLVIIKVKFCINVCQKKYIRDFRIQVNEIDNEQTEEEEEEEEDDDDIVKKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.1
10 0.09
11 0.09
12 0.09
13 0.1
14 0.15
15 0.2
16 0.26
17 0.33
18 0.42
19 0.49
20 0.6
21 0.68
22 0.74
23 0.8
24 0.84
25 0.85
26 0.86
27 0.88
28 0.85
29 0.83
30 0.78
31 0.75
32 0.73
33 0.65
34 0.63
35 0.59
36 0.55
37 0.57
38 0.61
39 0.56
40 0.51
41 0.56
42 0.56
43 0.58
44 0.62
45 0.62
46 0.62
47 0.66
48 0.64
49 0.64
50 0.59
51 0.52
52 0.48
53 0.42
54 0.33
55 0.27
56 0.26
57 0.2
58 0.18
59 0.15
60 0.1
61 0.08
62 0.07
63 0.06
64 0.05
65 0.03
66 0.03
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.07
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.05
86 0.05
87 0.04
88 0.05
89 0.05
90 0.05
91 0.07
92 0.08
93 0.14
94 0.17
95 0.19
96 0.24
97 0.26
98 0.34
99 0.41
100 0.51
101 0.56
102 0.63
103 0.69
104 0.71
105 0.75
106 0.73
107 0.69
108 0.68
109 0.65
110 0.59
111 0.55
112 0.54
113 0.54
114 0.55
115 0.51
116 0.4
117 0.33
118 0.3
119 0.25
120 0.19
121 0.13
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.09
130 0.09
131 0.11
132 0.17
133 0.19
134 0.22
135 0.24
136 0.25
137 0.28
138 0.3
139 0.3
140 0.26
141 0.24
142 0.23
143 0.22
144 0.2
145 0.18
146 0.15
147 0.12
148 0.12
149 0.12
150 0.11
151 0.12
152 0.21
153 0.29
154 0.39
155 0.42
156 0.51
157 0.53
158 0.59
159 0.67
160 0.68
161 0.64
162 0.63
163 0.65
164 0.64
165 0.71
166 0.65
167 0.58
168 0.52
169 0.48
170 0.4
171 0.38
172 0.3
173 0.22
174 0.2
175 0.18
176 0.15
177 0.13
178 0.13
179 0.11
180 0.11
181 0.1
182 0.11
183 0.11
184 0.1
185 0.09
186 0.09
187 0.1