Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VKS8

Protein Details
Accession A0A1Y1VKS8   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-74EDYKRHMEEKKKNKKIEKEKKKTEKRKKYKKYNSNNNYSYBasic
NLS Segment(s)
PositionSequence
41-65MEEKKKNKKIEKEKKKTEKRKKYKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MKYFLVLFKNFCFYVNNPIYRKILNIKIPYDYKEEDYKRHMEEKKKNKKIEKEKKKTEKRKKYKKYNSNNNYSYSYNNDYDSYDDYYDSFDEYNYQNNDEYLYLDPGNCFDSENEIDKAWFNYND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.42
4 0.39
5 0.43
6 0.44
7 0.41
8 0.42
9 0.39
10 0.39
11 0.39
12 0.42
13 0.4
14 0.43
15 0.45
16 0.44
17 0.43
18 0.37
19 0.33
20 0.37
21 0.37
22 0.35
23 0.38
24 0.39
25 0.37
26 0.44
27 0.46
28 0.47
29 0.55
30 0.62
31 0.69
32 0.74
33 0.78
34 0.77
35 0.82
36 0.84
37 0.85
38 0.85
39 0.84
40 0.86
41 0.9
42 0.93
43 0.94
44 0.93
45 0.93
46 0.93
47 0.94
48 0.94
49 0.94
50 0.94
51 0.93
52 0.93
53 0.93
54 0.9
55 0.88
56 0.8
57 0.72
58 0.64
59 0.55
60 0.46
61 0.39
62 0.36
63 0.27
64 0.26
65 0.23
66 0.2
67 0.2
68 0.21
69 0.19
70 0.15
71 0.14
72 0.13
73 0.13
74 0.13
75 0.12
76 0.1
77 0.07
78 0.09
79 0.1
80 0.16
81 0.16
82 0.18
83 0.17
84 0.17
85 0.19
86 0.17
87 0.18
88 0.13
89 0.15
90 0.14
91 0.14
92 0.14
93 0.14
94 0.15
95 0.13
96 0.13
97 0.1
98 0.16
99 0.19
100 0.23
101 0.23
102 0.22
103 0.23
104 0.23
105 0.26