Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UYW0

Protein Details
Accession A0A1Y1UYW0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
107-127MKQANKQLKKQYKKVNIDKIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.333, cyto 4, cyto_pero 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
GO:0032511  P:late endosome to vacuole transport via multivesicular body sorting pathway  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MNRLFGGSKKPAPTLEEAISNTDGRVDSVEVKIRRLDAELAKYKEQMSRMREGAAKNSVKQKAMRVLKQKKMYENQRDQLMQQSFNMEQTSFATENLKNTVTTVNAMKQANKQLKKQYKKVNIDKIEAMQDEMEDLLDQANEIQEALGRTYGLPEDIDEADLEAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.35
4 0.33
5 0.34
6 0.34
7 0.3
8 0.24
9 0.2
10 0.18
11 0.14
12 0.14
13 0.12
14 0.13
15 0.16
16 0.24
17 0.22
18 0.24
19 0.25
20 0.25
21 0.24
22 0.24
23 0.25
24 0.22
25 0.3
26 0.36
27 0.38
28 0.39
29 0.39
30 0.38
31 0.37
32 0.36
33 0.35
34 0.31
35 0.33
36 0.32
37 0.34
38 0.36
39 0.34
40 0.34
41 0.36
42 0.33
43 0.31
44 0.38
45 0.38
46 0.37
47 0.38
48 0.37
49 0.38
50 0.43
51 0.47
52 0.5
53 0.56
54 0.61
55 0.67
56 0.66
57 0.63
58 0.65
59 0.69
60 0.68
61 0.67
62 0.62
63 0.58
64 0.55
65 0.49
66 0.48
67 0.4
68 0.3
69 0.23
70 0.22
71 0.18
72 0.18
73 0.18
74 0.1
75 0.09
76 0.09
77 0.13
78 0.11
79 0.11
80 0.13
81 0.13
82 0.14
83 0.16
84 0.16
85 0.12
86 0.12
87 0.13
88 0.11
89 0.12
90 0.12
91 0.12
92 0.17
93 0.18
94 0.19
95 0.22
96 0.3
97 0.37
98 0.4
99 0.43
100 0.49
101 0.58
102 0.65
103 0.7
104 0.71
105 0.73
106 0.79
107 0.83
108 0.83
109 0.78
110 0.73
111 0.67
112 0.59
113 0.53
114 0.43
115 0.34
116 0.24
117 0.19
118 0.15
119 0.13
120 0.1
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.07
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.11
138 0.12
139 0.11
140 0.1
141 0.1
142 0.12
143 0.13
144 0.13
145 0.12
146 0.12