Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UYR0

Protein Details
Accession A0A1Y1UYR0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
144-178NEQQQESRLKPKPKRSYRGGKPKPKRGYGAGKPKPBasic
NLS Segment(s)
PositionSequence
151-181RLKPKPKRSYRGGKPKPKRGYGAGKPKPKPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MKFNSALISILFALACNANEIQNEIQNDEQQNPGLEPIDYLNPILTPPVTTEIFENPKLRPKPKGVFGSIEDPENEQPGSRLRPKPKGVFGSIEDPENEQPSSRLRPKPKGIFGSIEDPENEQPGSRLRPKPKGIFGSIEDPENEQQQESRLKPKPKRSYRGGKPKPKRGYGAGKPKPKPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.11
6 0.11
7 0.15
8 0.15
9 0.18
10 0.19
11 0.19
12 0.2
13 0.23
14 0.24
15 0.23
16 0.23
17 0.2
18 0.2
19 0.18
20 0.17
21 0.14
22 0.12
23 0.11
24 0.11
25 0.13
26 0.12
27 0.12
28 0.11
29 0.1
30 0.1
31 0.1
32 0.08
33 0.06
34 0.07
35 0.11
36 0.12
37 0.12
38 0.13
39 0.18
40 0.22
41 0.25
42 0.25
43 0.23
44 0.31
45 0.36
46 0.38
47 0.38
48 0.42
49 0.45
50 0.51
51 0.56
52 0.49
53 0.47
54 0.47
55 0.47
56 0.4
57 0.35
58 0.27
59 0.23
60 0.2
61 0.18
62 0.15
63 0.09
64 0.09
65 0.11
66 0.16
67 0.21
68 0.27
69 0.32
70 0.4
71 0.46
72 0.5
73 0.53
74 0.52
75 0.48
76 0.44
77 0.41
78 0.39
79 0.34
80 0.31
81 0.25
82 0.23
83 0.21
84 0.19
85 0.16
86 0.1
87 0.1
88 0.13
89 0.19
90 0.24
91 0.3
92 0.35
93 0.43
94 0.52
95 0.59
96 0.62
97 0.6
98 0.56
99 0.52
100 0.48
101 0.46
102 0.38
103 0.32
104 0.25
105 0.23
106 0.21
107 0.18
108 0.16
109 0.1
110 0.1
111 0.12
112 0.16
113 0.21
114 0.27
115 0.32
116 0.41
117 0.48
118 0.54
119 0.58
120 0.58
121 0.53
122 0.5
123 0.47
124 0.44
125 0.37
126 0.32
127 0.25
128 0.24
129 0.23
130 0.22
131 0.2
132 0.14
133 0.14
134 0.18
135 0.25
136 0.25
137 0.33
138 0.38
139 0.48
140 0.56
141 0.66
142 0.73
143 0.77
144 0.83
145 0.83
146 0.86
147 0.87
148 0.9
149 0.9
150 0.9
151 0.9
152 0.92
153 0.92
154 0.88
155 0.83
156 0.8
157 0.8
158 0.79
159 0.8
160 0.79
161 0.8