Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EH90

Protein Details
Accession H0EH90   
Localization Confidence High
Confidence Score 21.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-38IAPAAPQQHKQPSRKGKKAWRKNVDVTEIQHydrophilic
285-316VRLNAKRPERKTQVQRNKIKRRKEAERQAKMAHydrophilic
412-439KVESRRPISFAKKRKVKATEKWTHKDFMHydrophilic
NLS Segment(s)
PositionSequence
20-29PSRKGKKAWR
175-189KSKKKVAPKTLKHKP
290-333KRPERKTQVQRNKIKRRKEAERQAKMAADIKKKNEQTAQLKKIR
415-428SRRPISFAKKRKVK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.833, mito 5.5, cyto_mito 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MPIIGPAAIAPAAPQQHKQPSRKGKKAWRKNVDVTEIQLGLEEVRDEITKGGIIAEKDSADLFTLDTAGDVAIPKKYLKGAITLKADEIIAQRSAVPAVSMRKRPGEGTTDGIIGPKRQRTSYVSHKELLRLQKIADGRQDQALVEVTEASYDPWDVARDEAEAKQDPRFSFLEKSKKKVAPKTLKHKPISLAASGKDIPAVKKPEGGYSYNPVYTDYEERLIAEGEKELAAEEKRQRIAAAEQLKLDAATKSAAEAEAAEARADLSEWEEDSAWEGFESGNEDVRLNAKRPERKTQVQRNKIKRRKEAERQAKMAADIKKKNEQTAQLKKIRKALDEKDQARAAALIVAEDSDPSDGDDLELRRRKLGKIALPERDLELVLPDELQESLRLLKPEGNLLKDRYRNLLVRGKVESRRPISFAKKRKVKATEKWTHKDFMLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.39
4 0.48
5 0.54
6 0.6
7 0.66
8 0.75
9 0.82
10 0.85
11 0.85
12 0.88
13 0.92
14 0.93
15 0.91
16 0.89
17 0.89
18 0.87
19 0.83
20 0.74
21 0.67
22 0.6
23 0.51
24 0.41
25 0.32
26 0.24
27 0.17
28 0.15
29 0.11
30 0.07
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.1
39 0.12
40 0.12
41 0.13
42 0.14
43 0.14
44 0.14
45 0.14
46 0.13
47 0.11
48 0.1
49 0.09
50 0.07
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.07
59 0.09
60 0.1
61 0.11
62 0.12
63 0.14
64 0.18
65 0.18
66 0.25
67 0.29
68 0.35
69 0.39
70 0.38
71 0.37
72 0.34
73 0.33
74 0.26
75 0.22
76 0.18
77 0.14
78 0.13
79 0.13
80 0.12
81 0.13
82 0.11
83 0.09
84 0.1
85 0.17
86 0.24
87 0.28
88 0.31
89 0.34
90 0.36
91 0.37
92 0.38
93 0.35
94 0.31
95 0.31
96 0.29
97 0.27
98 0.25
99 0.25
100 0.22
101 0.21
102 0.23
103 0.24
104 0.25
105 0.25
106 0.29
107 0.32
108 0.38
109 0.45
110 0.5
111 0.48
112 0.5
113 0.5
114 0.5
115 0.51
116 0.51
117 0.44
118 0.36
119 0.32
120 0.33
121 0.34
122 0.33
123 0.33
124 0.28
125 0.26
126 0.27
127 0.27
128 0.22
129 0.21
130 0.2
131 0.13
132 0.11
133 0.1
134 0.07
135 0.07
136 0.07
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.07
143 0.07
144 0.07
145 0.07
146 0.08
147 0.1
148 0.11
149 0.14
150 0.15
151 0.16
152 0.18
153 0.22
154 0.21
155 0.23
156 0.23
157 0.22
158 0.26
159 0.32
160 0.4
161 0.39
162 0.44
163 0.49
164 0.53
165 0.57
166 0.59
167 0.62
168 0.62
169 0.69
170 0.74
171 0.75
172 0.79
173 0.75
174 0.7
175 0.62
176 0.57
177 0.51
178 0.43
179 0.36
180 0.27
181 0.28
182 0.25
183 0.23
184 0.18
185 0.16
186 0.14
187 0.18
188 0.21
189 0.18
190 0.22
191 0.23
192 0.25
193 0.27
194 0.28
195 0.24
196 0.24
197 0.26
198 0.23
199 0.22
200 0.19
201 0.17
202 0.17
203 0.17
204 0.14
205 0.13
206 0.12
207 0.12
208 0.12
209 0.11
210 0.09
211 0.07
212 0.06
213 0.05
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.11
220 0.14
221 0.18
222 0.18
223 0.19
224 0.19
225 0.19
226 0.2
227 0.22
228 0.24
229 0.21
230 0.2
231 0.21
232 0.2
233 0.19
234 0.18
235 0.11
236 0.07
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.05
243 0.05
244 0.06
245 0.07
246 0.08
247 0.07
248 0.07
249 0.07
250 0.07
251 0.06
252 0.05
253 0.05
254 0.05
255 0.06
256 0.06
257 0.07
258 0.07
259 0.09
260 0.09
261 0.07
262 0.06
263 0.07
264 0.06
265 0.06
266 0.09
267 0.07
268 0.1
269 0.1
270 0.1
271 0.11
272 0.15
273 0.17
274 0.15
275 0.21
276 0.26
277 0.34
278 0.39
279 0.48
280 0.52
281 0.6
282 0.69
283 0.74
284 0.78
285 0.8
286 0.85
287 0.87
288 0.9
289 0.89
290 0.88
291 0.86
292 0.84
293 0.84
294 0.85
295 0.85
296 0.85
297 0.85
298 0.79
299 0.72
300 0.64
301 0.56
302 0.52
303 0.48
304 0.45
305 0.42
306 0.44
307 0.49
308 0.49
309 0.52
310 0.5
311 0.52
312 0.53
313 0.59
314 0.63
315 0.63
316 0.68
317 0.67
318 0.7
319 0.65
320 0.6
321 0.58
322 0.55
323 0.57
324 0.6
325 0.59
326 0.58
327 0.55
328 0.49
329 0.42
330 0.36
331 0.25
332 0.17
333 0.15
334 0.09
335 0.07
336 0.08
337 0.07
338 0.07
339 0.07
340 0.05
341 0.05
342 0.06
343 0.06
344 0.06
345 0.07
346 0.11
347 0.12
348 0.22
349 0.28
350 0.28
351 0.33
352 0.36
353 0.37
354 0.41
355 0.47
356 0.45
357 0.5
358 0.58
359 0.59
360 0.58
361 0.58
362 0.52
363 0.45
364 0.37
365 0.27
366 0.2
367 0.14
368 0.13
369 0.12
370 0.1
371 0.09
372 0.09
373 0.1
374 0.08
375 0.08
376 0.12
377 0.15
378 0.16
379 0.17
380 0.21
381 0.21
382 0.3
383 0.34
384 0.35
385 0.37
386 0.41
387 0.48
388 0.49
389 0.51
390 0.48
391 0.49
392 0.48
393 0.5
394 0.54
395 0.49
396 0.48
397 0.52
398 0.53
399 0.54
400 0.58
401 0.6
402 0.57
403 0.57
404 0.57
405 0.59
406 0.62
407 0.66
408 0.68
409 0.7
410 0.73
411 0.76
412 0.82
413 0.84
414 0.83
415 0.83
416 0.84
417 0.84
418 0.84
419 0.87
420 0.81
421 0.75