Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VDM7

Protein Details
Accession A0A1Y1VDM7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
163-185ALAYNKLEWKKRKRMFNNAWDIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010776  Hop2_WH_dom  
IPR040661  LZ3wCH  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0120231  C:DNA recombinase auxiliary factor complex  
GO:0005634  C:nucleus  
GO:0120230  F:recombinase activator activity  
GO:0007129  P:homologous chromosome pairing at meiosis  
GO:0000709  P:meiotic joint molecule formation  
GO:0010774  P:meiotic strand invasion involved in reciprocal meiotic recombination  
Pfam View protein in Pfam  
PF18517  LZ3wCH  
PF07106  TBPIP  
Amino Acid Sequences MAKPQKTLKDSEAIEYILNYLKKQNRPYSAADVYNNLHGVVGKTLVQKILQKSSEENKIKEKIYGKQKVYVAIQDDEDFSPEDLLNLDKTIEELQKELKEEKTKTNSLKSKLNNLNNSMTDEEIVEKLNSIHEENQNLEERLNTLTTGVKLISKEEQNEIDKALAYNKLEWKKRKRMFNNAWDIITENMPKKPKELMEELGIETGNANY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.24
4 0.21
5 0.21
6 0.18
7 0.23
8 0.3
9 0.37
10 0.45
11 0.52
12 0.54
13 0.58
14 0.62
15 0.63
16 0.61
17 0.58
18 0.5
19 0.45
20 0.4
21 0.38
22 0.33
23 0.24
24 0.19
25 0.15
26 0.15
27 0.12
28 0.11
29 0.11
30 0.13
31 0.14
32 0.15
33 0.17
34 0.2
35 0.24
36 0.3
37 0.29
38 0.28
39 0.32
40 0.37
41 0.45
42 0.45
43 0.43
44 0.43
45 0.46
46 0.45
47 0.46
48 0.44
49 0.41
50 0.47
51 0.54
52 0.49
53 0.5
54 0.51
55 0.5
56 0.47
57 0.42
58 0.35
59 0.27
60 0.26
61 0.2
62 0.2
63 0.17
64 0.16
65 0.13
66 0.1
67 0.1
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.06
77 0.08
78 0.09
79 0.08
80 0.09
81 0.11
82 0.13
83 0.15
84 0.16
85 0.17
86 0.22
87 0.24
88 0.3
89 0.33
90 0.36
91 0.37
92 0.44
93 0.46
94 0.44
95 0.49
96 0.44
97 0.48
98 0.52
99 0.56
100 0.51
101 0.49
102 0.49
103 0.42
104 0.43
105 0.33
106 0.25
107 0.18
108 0.15
109 0.12
110 0.09
111 0.1
112 0.07
113 0.07
114 0.07
115 0.08
116 0.09
117 0.1
118 0.14
119 0.15
120 0.17
121 0.18
122 0.21
123 0.23
124 0.22
125 0.21
126 0.16
127 0.15
128 0.15
129 0.14
130 0.1
131 0.08
132 0.1
133 0.1
134 0.11
135 0.1
136 0.11
137 0.11
138 0.13
139 0.17
140 0.18
141 0.2
142 0.22
143 0.27
144 0.27
145 0.28
146 0.26
147 0.22
148 0.2
149 0.19
150 0.18
151 0.17
152 0.15
153 0.19
154 0.26
155 0.34
156 0.41
157 0.5
158 0.57
159 0.65
160 0.71
161 0.78
162 0.79
163 0.82
164 0.84
165 0.85
166 0.86
167 0.79
168 0.72
169 0.62
170 0.54
171 0.45
172 0.38
173 0.32
174 0.25
175 0.27
176 0.32
177 0.32
178 0.32
179 0.37
180 0.38
181 0.4
182 0.43
183 0.41
184 0.41
185 0.43
186 0.42
187 0.37
188 0.32
189 0.25