Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UN74

Protein Details
Accession A0A1Y1UN74    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
289-318NNNNNYYSKKYYNRPPKQYNGPNPNPNSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009818  Ataxin-2_C  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR022894  Oligoribonuclease  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF07145  PAM2  
PF00929  RNase_T  
CDD cd06135  Orn  
Amino Acid Sequences MSKKVLEENLIVWIDCEMTGLDLDKDHIIEIACIVTDKDLNILDEAPDIIINFPEEVITSMNEWSWEHHTKSGLVDAMRQSKISLEEADTIISKFIGKHFPNKCSAILAGNSVHVDKKFLEKDFPKTFEYFHYRIIDVSTIKEITRRWYPEIFSKLPTFQNLHRALDDIRGSIKELNYYREMVFKHKLNPSATEFVPSTSYNNNNNNNNISNNNNSQNPNPYINNNKNAGYRKNDTVYYNNNNINNSSMVRPMHPNNNYPYYNKDYRPNYNHGGNTYNNNSNNNYNNNNNNNNYYSKKYYNRPPKQYNGPNPNPNSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.07
5 0.07
6 0.08
7 0.09
8 0.09
9 0.09
10 0.11
11 0.11
12 0.11
13 0.1
14 0.11
15 0.1
16 0.1
17 0.1
18 0.09
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.1
26 0.11
27 0.12
28 0.13
29 0.13
30 0.12
31 0.12
32 0.12
33 0.09
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.08
45 0.08
46 0.09
47 0.09
48 0.09
49 0.1
50 0.1
51 0.12
52 0.18
53 0.22
54 0.23
55 0.26
56 0.27
57 0.27
58 0.28
59 0.28
60 0.24
61 0.19
62 0.22
63 0.24
64 0.29
65 0.28
66 0.27
67 0.24
68 0.23
69 0.25
70 0.23
71 0.19
72 0.15
73 0.17
74 0.17
75 0.17
76 0.16
77 0.14
78 0.12
79 0.11
80 0.09
81 0.07
82 0.1
83 0.18
84 0.19
85 0.28
86 0.33
87 0.37
88 0.42
89 0.43
90 0.41
91 0.34
92 0.33
93 0.26
94 0.22
95 0.2
96 0.16
97 0.14
98 0.14
99 0.13
100 0.14
101 0.11
102 0.12
103 0.1
104 0.16
105 0.19
106 0.19
107 0.26
108 0.28
109 0.36
110 0.4
111 0.43
112 0.39
113 0.36
114 0.36
115 0.35
116 0.39
117 0.33
118 0.32
119 0.31
120 0.28
121 0.28
122 0.28
123 0.24
124 0.17
125 0.16
126 0.13
127 0.11
128 0.11
129 0.13
130 0.13
131 0.15
132 0.2
133 0.22
134 0.24
135 0.26
136 0.28
137 0.32
138 0.38
139 0.35
140 0.32
141 0.3
142 0.29
143 0.28
144 0.28
145 0.24
146 0.19
147 0.27
148 0.27
149 0.26
150 0.24
151 0.24
152 0.22
153 0.24
154 0.23
155 0.14
156 0.12
157 0.12
158 0.13
159 0.13
160 0.13
161 0.14
162 0.15
163 0.18
164 0.19
165 0.2
166 0.2
167 0.21
168 0.22
169 0.22
170 0.25
171 0.24
172 0.29
173 0.31
174 0.36
175 0.34
176 0.37
177 0.36
178 0.36
179 0.33
180 0.3
181 0.26
182 0.22
183 0.23
184 0.19
185 0.17
186 0.17
187 0.21
188 0.25
189 0.32
190 0.37
191 0.38
192 0.4
193 0.41
194 0.39
195 0.37
196 0.33
197 0.29
198 0.27
199 0.28
200 0.29
201 0.3
202 0.3
203 0.3
204 0.35
205 0.35
206 0.35
207 0.32
208 0.33
209 0.39
210 0.43
211 0.47
212 0.43
213 0.42
214 0.44
215 0.47
216 0.48
217 0.45
218 0.43
219 0.43
220 0.43
221 0.44
222 0.41
223 0.41
224 0.44
225 0.44
226 0.46
227 0.45
228 0.44
229 0.42
230 0.4
231 0.36
232 0.3
233 0.25
234 0.21
235 0.2
236 0.19
237 0.2
238 0.25
239 0.27
240 0.35
241 0.37
242 0.4
243 0.42
244 0.49
245 0.49
246 0.45
247 0.47
248 0.46
249 0.49
250 0.48
251 0.5
252 0.5
253 0.57
254 0.62
255 0.62
256 0.6
257 0.6
258 0.6
259 0.54
260 0.51
261 0.44
262 0.44
263 0.43
264 0.45
265 0.41
266 0.41
267 0.42
268 0.43
269 0.46
270 0.46
271 0.45
272 0.44
273 0.51
274 0.55
275 0.59
276 0.57
277 0.56
278 0.53
279 0.53
280 0.51
281 0.49
282 0.48
283 0.5
284 0.53
285 0.57
286 0.65
287 0.71
288 0.77
289 0.8
290 0.82
291 0.83
292 0.86
293 0.89
294 0.89
295 0.88
296 0.87
297 0.87
298 0.83