Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VMI4

Protein Details
Accession A0A1Y1VMI4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
77-99ETPKTGKGQKKAKPVNKDRFIPKBasic
NLS Segment(s)
PositionSequence
86-89KKAK
Subcellular Location(s) nucl 17, cyto_nucl 13.333, cyto 7.5, cyto_pero 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR027248  Sm_D2  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005829  C:cytosol  
GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0000974  C:Prp19 complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01720  Sm_D2  
Amino Acid Sequences MSGVVDKPKSEMTEEELRKIEEEEFNSGPLSVLSQSVKNNTQILISCRNNKKLLARVKAFDRHMNMVLENVKEMWTETPKTGKGQKKAKPVNKDRFIPKMFLRGDSVILVLRNIQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.35
4 0.34
5 0.33
6 0.32
7 0.29
8 0.23
9 0.24
10 0.24
11 0.23
12 0.23
13 0.22
14 0.21
15 0.18
16 0.13
17 0.12
18 0.07
19 0.09
20 0.09
21 0.12
22 0.13
23 0.17
24 0.19
25 0.2
26 0.2
27 0.18
28 0.19
29 0.18
30 0.21
31 0.25
32 0.26
33 0.33
34 0.36
35 0.41
36 0.41
37 0.41
38 0.41
39 0.41
40 0.46
41 0.45
42 0.43
43 0.41
44 0.44
45 0.47
46 0.45
47 0.4
48 0.35
49 0.3
50 0.3
51 0.28
52 0.24
53 0.2
54 0.2
55 0.16
56 0.14
57 0.11
58 0.09
59 0.09
60 0.1
61 0.1
62 0.11
63 0.13
64 0.14
65 0.18
66 0.19
67 0.24
68 0.32
69 0.37
70 0.42
71 0.5
72 0.55
73 0.62
74 0.71
75 0.75
76 0.78
77 0.81
78 0.83
79 0.81
80 0.82
81 0.77
82 0.76
83 0.7
84 0.65
85 0.57
86 0.55
87 0.49
88 0.44
89 0.42
90 0.34
91 0.34
92 0.29
93 0.27
94 0.2
95 0.19
96 0.17