Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VBR5

Protein Details
Accession A0A1Y1VBR5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
30-55IKILYFKSRFKKKAPSKKVIAKEKWEHydrophilic
NLS Segment(s)
PositionSequence
37-53SRFKKKAPSKKVIAKEK
Subcellular Location(s) cyto_nucl 13, nucl 11.5, cyto 9.5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013144  CRA_dom  
IPR024964  CTLH/CRA  
IPR006595  CTLH_C  
IPR006594  LisH  
Gene Ontology GO:0016020  C:membrane  
GO:0045721  P:negative regulation of gluconeogenesis  
Pfam View protein in Pfam  
PF10607  CTLH  
PF08513  LisH  
PROSITE View protein in PROSITE  
PS50897  CTLH  
PS50896  LISH  
Amino Acid Sequences MTIELIINLFYYYYFILYYHFLIIIIIIIIKILYFKSRFKKKAPSKKVIAKEKWESKLANVSVDKKDLNKLIMNYLVIEGYKDAAEKFSQESGLQPSVDLLYIEERMNIRNTIQSGNIDEAIEKVNDLDPEILDNNPVLYFHLQQQKLIEYIKQNKIVEAIEFAQEELAPRGEENPEFLEDLEQTMALLAFDDNDKSPVKSLLEHSQRQKTASELNAAILTSQCQDRDPRLLSLLKLLSWSQDQLNEKASFPNIKNYVTAKLEPTNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.12
5 0.13
6 0.13
7 0.12
8 0.11
9 0.11
10 0.11
11 0.09
12 0.07
13 0.06
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.1
21 0.13
22 0.2
23 0.31
24 0.42
25 0.47
26 0.53
27 0.64
28 0.7
29 0.78
30 0.82
31 0.81
32 0.8
33 0.84
34 0.87
35 0.87
36 0.83
37 0.8
38 0.8
39 0.79
40 0.74
41 0.69
42 0.59
43 0.52
44 0.54
45 0.46
46 0.42
47 0.37
48 0.38
49 0.35
50 0.37
51 0.36
52 0.28
53 0.32
54 0.28
55 0.28
56 0.27
57 0.25
58 0.26
59 0.26
60 0.25
61 0.21
62 0.19
63 0.16
64 0.12
65 0.11
66 0.08
67 0.07
68 0.07
69 0.06
70 0.06
71 0.07
72 0.08
73 0.09
74 0.1
75 0.11
76 0.11
77 0.11
78 0.13
79 0.16
80 0.17
81 0.16
82 0.14
83 0.13
84 0.13
85 0.13
86 0.11
87 0.07
88 0.06
89 0.08
90 0.08
91 0.09
92 0.09
93 0.11
94 0.12
95 0.12
96 0.11
97 0.12
98 0.14
99 0.13
100 0.14
101 0.13
102 0.13
103 0.14
104 0.14
105 0.12
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.06
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.07
118 0.08
119 0.07
120 0.06
121 0.06
122 0.06
123 0.05
124 0.06
125 0.05
126 0.06
127 0.07
128 0.12
129 0.2
130 0.2
131 0.21
132 0.22
133 0.22
134 0.22
135 0.21
136 0.19
137 0.17
138 0.25
139 0.3
140 0.35
141 0.34
142 0.32
143 0.34
144 0.32
145 0.25
146 0.2
147 0.16
148 0.11
149 0.11
150 0.11
151 0.09
152 0.09
153 0.09
154 0.08
155 0.08
156 0.06
157 0.06
158 0.08
159 0.09
160 0.09
161 0.11
162 0.11
163 0.12
164 0.12
165 0.12
166 0.12
167 0.1
168 0.11
169 0.09
170 0.07
171 0.06
172 0.06
173 0.06
174 0.04
175 0.05
176 0.03
177 0.04
178 0.05
179 0.06
180 0.06
181 0.09
182 0.1
183 0.1
184 0.12
185 0.14
186 0.15
187 0.16
188 0.2
189 0.28
190 0.35
191 0.4
192 0.46
193 0.52
194 0.52
195 0.51
196 0.48
197 0.41
198 0.39
199 0.36
200 0.34
201 0.26
202 0.25
203 0.25
204 0.24
205 0.21
206 0.15
207 0.13
208 0.1
209 0.12
210 0.11
211 0.12
212 0.16
213 0.19
214 0.26
215 0.28
216 0.28
217 0.31
218 0.33
219 0.32
220 0.35
221 0.33
222 0.26
223 0.25
224 0.23
225 0.21
226 0.21
227 0.23
228 0.18
229 0.23
230 0.27
231 0.27
232 0.33
233 0.32
234 0.31
235 0.32
236 0.34
237 0.35
238 0.33
239 0.4
240 0.37
241 0.37
242 0.4
243 0.4
244 0.43
245 0.4
246 0.41
247 0.36