Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VI96

Protein Details
Accession A0A1Y1VI96    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
1-30TKKESKSSKSDEKPNKRKRKEDGAPKRPMIBasic
66-88ASPEEKKKYEKKALEDKERYKREBasic
NLS Segment(s)
PositionSequence
5-27SKSSKSDEKPNKRKRKEDGAPKR
71-78KKKYEKKA
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences TKKESKSSKSDEKPNKRKRKEDGAPKRPMISFMFFSQDKRAEVKRDNPDASFGEIGKIIGNLWKNASPEEKKKYEKKALEDKERYKRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.89
4 0.89
5 0.87
6 0.87
7 0.86
8 0.86
9 0.86
10 0.85
11 0.84
12 0.78
13 0.73
14 0.62
15 0.55
16 0.46
17 0.39
18 0.31
19 0.24
20 0.27
21 0.23
22 0.24
23 0.25
24 0.24
25 0.22
26 0.23
27 0.24
28 0.24
29 0.28
30 0.35
31 0.38
32 0.42
33 0.42
34 0.38
35 0.39
36 0.35
37 0.34
38 0.26
39 0.19
40 0.14
41 0.13
42 0.12
43 0.09
44 0.08
45 0.06
46 0.08
47 0.1
48 0.1
49 0.12
50 0.15
51 0.15
52 0.18
53 0.25
54 0.29
55 0.36
56 0.43
57 0.48
58 0.54
59 0.61
60 0.68
61 0.71
62 0.72
63 0.72
64 0.75
65 0.77
66 0.8
67 0.82
68 0.82