Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UPH8

Protein Details
Accession A0A1Y1UPH8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
106-133VSSLSSNNQSKNKKRKRNKSDLQQLLSKHydrophilic
NLS Segment(s)
PositionSequence
116-124KNKKRKRNK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MDCMDEDEKPNNTCNNEKLYYSLEDKNDNFQYYKYSNVVKYTCNVCRKETIFNGTSNNYKLEKPSLETIDEEMEMNLPNKFTNKKSAIDVNKPNPNHSRNNSNTSVSSLSSNNQSKNKKRKRNKSDLQQLLSKSNENKKPKTYSLNDFLSNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.38
4 0.37
5 0.36
6 0.35
7 0.34
8 0.34
9 0.36
10 0.31
11 0.34
12 0.35
13 0.39
14 0.39
15 0.37
16 0.33
17 0.28
18 0.32
19 0.27
20 0.3
21 0.26
22 0.27
23 0.27
24 0.31
25 0.33
26 0.28
27 0.31
28 0.33
29 0.38
30 0.41
31 0.41
32 0.38
33 0.43
34 0.44
35 0.46
36 0.43
37 0.42
38 0.36
39 0.35
40 0.36
41 0.32
42 0.32
43 0.27
44 0.26
45 0.21
46 0.2
47 0.2
48 0.2
49 0.19
50 0.19
51 0.22
52 0.21
53 0.2
54 0.2
55 0.2
56 0.17
57 0.16
58 0.13
59 0.09
60 0.08
61 0.07
62 0.08
63 0.07
64 0.06
65 0.06
66 0.08
67 0.11
68 0.12
69 0.2
70 0.22
71 0.24
72 0.27
73 0.34
74 0.38
75 0.43
76 0.49
77 0.48
78 0.52
79 0.5
80 0.52
81 0.51
82 0.5
83 0.5
84 0.46
85 0.49
86 0.47
87 0.53
88 0.52
89 0.47
90 0.43
91 0.38
92 0.36
93 0.27
94 0.24
95 0.19
96 0.17
97 0.23
98 0.27
99 0.29
100 0.35
101 0.43
102 0.51
103 0.61
104 0.71
105 0.74
106 0.81
107 0.87
108 0.9
109 0.93
110 0.93
111 0.93
112 0.93
113 0.91
114 0.85
115 0.8
116 0.72
117 0.65
118 0.57
119 0.51
120 0.47
121 0.47
122 0.52
123 0.54
124 0.58
125 0.61
126 0.66
127 0.68
128 0.71
129 0.69
130 0.68
131 0.68
132 0.67