Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VJ38

Protein Details
Accession A0A1Y1VJ38    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-35NYFVPEKKAKPKTPLKSKKEKKIEKEYVIAHydrophilic
NLS Segment(s)
PositionSequence
12-28KKAKPKTPLKSKKEKKI
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034907  NDK-like_dom  
IPR036850  NDK-like_dom_sf  
Pfam View protein in Pfam  
PF00334  NDK  
Amino Acid Sequences MTLYINYFVPEKKAKPKTPLKSKKEKKIEKEYVIAILKSEVLRNDIIEKIIEIFMKNSFAIEEKKDVELSSDQVSLLYSDLADDNPLKSKHIEYMSSNPCLAFLLAREDPFTLLNELSGPENPTVAKEENPERFNNFIFYLIIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.7
4 0.75
5 0.8
6 0.86
7 0.84
8 0.86
9 0.89
10 0.9
11 0.91
12 0.89
13 0.87
14 0.88
15 0.88
16 0.82
17 0.76
18 0.66
19 0.62
20 0.55
21 0.45
22 0.34
23 0.25
24 0.22
25 0.18
26 0.18
27 0.12
28 0.12
29 0.12
30 0.13
31 0.14
32 0.13
33 0.13
34 0.12
35 0.11
36 0.1
37 0.11
38 0.11
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.08
45 0.08
46 0.09
47 0.11
48 0.12
49 0.14
50 0.13
51 0.14
52 0.15
53 0.14
54 0.14
55 0.13
56 0.13
57 0.12
58 0.11
59 0.1
60 0.1
61 0.1
62 0.08
63 0.07
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.11
73 0.11
74 0.12
75 0.13
76 0.14
77 0.18
78 0.2
79 0.22
80 0.21
81 0.3
82 0.33
83 0.34
84 0.33
85 0.28
86 0.25
87 0.23
88 0.2
89 0.11
90 0.08
91 0.13
92 0.14
93 0.14
94 0.15
95 0.15
96 0.15
97 0.16
98 0.17
99 0.12
100 0.1
101 0.1
102 0.1
103 0.11
104 0.11
105 0.12
106 0.13
107 0.11
108 0.12
109 0.12
110 0.13
111 0.17
112 0.17
113 0.17
114 0.21
115 0.29
116 0.36
117 0.39
118 0.41
119 0.4
120 0.41
121 0.41
122 0.39
123 0.31
124 0.25