Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VFU0

Protein Details
Accession A0A1Y1VFU0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20GRCGPKYGRCPKTKYCCSKWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.833, nucl 13.5, mito 12, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR018371  Chitin-binding_1_CS  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS00026  CHIT_BIND_I_1  
PS50941  CHIT_BIND_I_2  
Amino Acid Sequences GRCGPKYGRCPKTKYCCSKWGYCGTSSDYCGKKKDVNPATVNVIRMPDFFSKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.76
4 0.74
5 0.73
6 0.69
7 0.67
8 0.59
9 0.5
10 0.46
11 0.42
12 0.38
13 0.34
14 0.34
15 0.29
16 0.28
17 0.29
18 0.3
19 0.31
20 0.33
21 0.42
22 0.42
23 0.45
24 0.46
25 0.47
26 0.51
27 0.47
28 0.45
29 0.35
30 0.32
31 0.25
32 0.23
33 0.25
34 0.21