Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V1Z1

Protein Details
Accession A0A1Y1V1Z1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNNKRNTDNKGNYNRKRSKNHNSISNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNNKRNTDNKGNYNRKRSKNHNSISNIEKEYTPSYEEINFMYGNNIDSIEYDKEKIITNLCDNDINYHSETDVHVTNEINILNTEYSFPELSSENDANNKIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.85
4 0.85
5 0.85
6 0.85
7 0.83
8 0.82
9 0.77
10 0.73
11 0.69
12 0.65
13 0.56
14 0.46
15 0.39
16 0.33
17 0.29
18 0.25
19 0.22
20 0.16
21 0.16
22 0.16
23 0.16
24 0.14
25 0.13
26 0.12
27 0.1
28 0.1
29 0.09
30 0.09
31 0.08
32 0.08
33 0.06
34 0.06
35 0.09
36 0.09
37 0.1
38 0.1
39 0.1
40 0.1
41 0.11
42 0.12
43 0.11
44 0.12
45 0.13
46 0.15
47 0.16
48 0.16
49 0.16
50 0.18
51 0.18
52 0.18
53 0.17
54 0.15
55 0.14
56 0.13
57 0.13
58 0.13
59 0.13
60 0.11
61 0.12
62 0.12
63 0.12
64 0.13
65 0.13
66 0.11
67 0.1
68 0.1
69 0.1
70 0.1
71 0.11
72 0.1
73 0.12
74 0.12
75 0.12
76 0.12
77 0.13
78 0.15
79 0.2
80 0.21
81 0.2
82 0.24