Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UYM3

Protein Details
Accession A0A1Y1UYM3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTQKRRNNGRNKHGRGHVKFBasic
82-115HIVRVRSREGRRNRAPPQRFRFNKDGKKVTPNKAHydrophilic
NLS Segment(s)
PositionSequence
87-114RSREGRRNRAPPQRFRFNKDGKKVTPNK
Subcellular Location(s) mito 18.5, mito_nucl 12.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MTQKRRNNGRNKHGRGHVKFVRCANCSRAVPKDKAIKRFLIRNMVEAAAVRDIAENSVYDNVVLPKLYIKMHYCISCGIHSHIVRVRSREGRRNRAPPQRFRFNKDGKKVTPNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.79
4 0.75
5 0.7
6 0.68
7 0.66
8 0.64
9 0.56
10 0.55
11 0.49
12 0.49
13 0.45
14 0.44
15 0.46
16 0.45
17 0.45
18 0.49
19 0.54
20 0.52
21 0.57
22 0.56
23 0.54
24 0.51
25 0.55
26 0.53
27 0.52
28 0.47
29 0.42
30 0.4
31 0.33
32 0.3
33 0.23
34 0.2
35 0.1
36 0.1
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.06
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.06
53 0.08
54 0.09
55 0.11
56 0.13
57 0.15
58 0.19
59 0.19
60 0.19
61 0.19
62 0.21
63 0.19
64 0.19
65 0.19
66 0.22
67 0.22
68 0.25
69 0.27
70 0.3
71 0.31
72 0.33
73 0.36
74 0.39
75 0.46
76 0.51
77 0.57
78 0.62
79 0.69
80 0.76
81 0.79
82 0.81
83 0.83
84 0.84
85 0.84
86 0.84
87 0.81
88 0.79
89 0.8
90 0.8
91 0.81
92 0.8
93 0.8
94 0.75
95 0.8