Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UQV0

Protein Details
Accession A0A1Y1UQV0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-103VMRQTIPATKKPKKTIRKCRVILHHQKSHIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MKKNTEEEPSLSSDEEKAEEVTPVEEVEEIDLADENVNEDVIEDEKSTELDENDEIKEEINSTTIRHITKTVTVMRQTIPATKKPKKTIRKCRVILHHQKSHIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.14
5 0.13
6 0.13
7 0.13
8 0.12
9 0.11
10 0.1
11 0.09
12 0.07
13 0.07
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.05
28 0.05
29 0.06
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.08
49 0.07
50 0.1
51 0.13
52 0.14
53 0.14
54 0.15
55 0.15
56 0.18
57 0.21
58 0.24
59 0.25
60 0.27
61 0.28
62 0.27
63 0.3
64 0.28
65 0.31
66 0.3
67 0.33
68 0.41
69 0.48
70 0.55
71 0.61
72 0.7
73 0.74
74 0.82
75 0.86
76 0.87
77 0.89
78 0.87
79 0.86
80 0.87
81 0.87
82 0.87
83 0.85
84 0.83