Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VCB5

Protein Details
Accession A0A1Y1VCB5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-70VTRGKGFRNEKNKKKRGSYRGGKIDLEBasic
NLS Segment(s)
PositionSequence
46-63RGKGFRNEKNKKKRGSYR
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences NEPFKRIKDEDVVFLDERLKDNSFMAKGGAIGSYGEKAHRDLIVTRGKGFRNEKNKKKRGSYRGGKIDLESHSIKFNFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.26
4 0.25
5 0.23
6 0.21
7 0.17
8 0.18
9 0.21
10 0.19
11 0.18
12 0.16
13 0.13
14 0.12
15 0.11
16 0.1
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.09
26 0.09
27 0.1
28 0.09
29 0.16
30 0.22
31 0.22
32 0.23
33 0.26
34 0.26
35 0.32
36 0.37
37 0.39
38 0.43
39 0.53
40 0.62
41 0.69
42 0.76
43 0.77
44 0.82
45 0.84
46 0.83
47 0.84
48 0.83
49 0.83
50 0.84
51 0.81
52 0.72
53 0.63
54 0.58
55 0.5
56 0.45
57 0.37
58 0.28
59 0.3