Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VGS1

Protein Details
Accession A0A1Y1VGS1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-28IENKKNIKDLPKYKKPVRNLPVRLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, nucl 7, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019013  Vma21  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0033116  C:endoplasmic reticulum-Golgi intermediate compartment membrane  
GO:0012507  C:ER to Golgi transport vesicle membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF09446  VMA21  
Amino Acid Sequences MGSAIENKKNIKDLPKYKKPVRNLPVRLPKQNRIPKNVLYKLIFFTILMFTLPFITYFFTIDRFFTGNTTYAALAAAFTANLIVAAYVVVAIIEDKDDDENINSNKKTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.74
4 0.78
5 0.82
6 0.82
7 0.82
8 0.8
9 0.8
10 0.77
11 0.78
12 0.8
13 0.78
14 0.8
15 0.76
16 0.74
17 0.74
18 0.76
19 0.72
20 0.68
21 0.67
22 0.64
23 0.67
24 0.64
25 0.59
26 0.51
27 0.47
28 0.41
29 0.37
30 0.3
31 0.2
32 0.16
33 0.11
34 0.1
35 0.08
36 0.06
37 0.05
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.1
50 0.1
51 0.1
52 0.1
53 0.11
54 0.1
55 0.11
56 0.11
57 0.1
58 0.09
59 0.09
60 0.08
61 0.06
62 0.05
63 0.05
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.08
86 0.1
87 0.16
88 0.19
89 0.27