Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UVN2

Protein Details
Accession A0A1Y1UVN2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-115GWINKWNNKKKISKNFKIRKSKSKYIGNLHydrophilic
NLS Segment(s)
PositionSequence
95-109KKKISKNFKIRKSKS
Subcellular Location(s) mito 14.5, mito_nucl 10.5, nucl 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MLKVRKRIDGIPIFDKLDRPLYHLNSENEINKYMVVVDEINNIEGHYIKLDDCLKEKYEKMNIYTKSPLSNNTYIIEDQSSIKSVLGWINKWNNKKKISKNFKIRKSKSKYIGNLNNEIPLIIKLFKYNKNKKIEMNTIHLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.35
4 0.35
5 0.3
6 0.3
7 0.35
8 0.36
9 0.4
10 0.44
11 0.44
12 0.39
13 0.43
14 0.41
15 0.35
16 0.33
17 0.28
18 0.22
19 0.19
20 0.16
21 0.12
22 0.1
23 0.09
24 0.08
25 0.11
26 0.12
27 0.12
28 0.12
29 0.11
30 0.1
31 0.1
32 0.09
33 0.06
34 0.07
35 0.06
36 0.1
37 0.12
38 0.13
39 0.15
40 0.17
41 0.19
42 0.21
43 0.22
44 0.23
45 0.28
46 0.29
47 0.29
48 0.35
49 0.34
50 0.35
51 0.36
52 0.32
53 0.29
54 0.27
55 0.27
56 0.25
57 0.26
58 0.23
59 0.21
60 0.22
61 0.19
62 0.19
63 0.16
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.09
72 0.12
73 0.13
74 0.13
75 0.17
76 0.26
77 0.31
78 0.39
79 0.47
80 0.5
81 0.56
82 0.64
83 0.69
84 0.72
85 0.77
86 0.8
87 0.82
88 0.85
89 0.87
90 0.9
91 0.87
92 0.86
93 0.85
94 0.84
95 0.82
96 0.82
97 0.78
98 0.78
99 0.8
100 0.74
101 0.71
102 0.62
103 0.55
104 0.45
105 0.38
106 0.29
107 0.2
108 0.17
109 0.13
110 0.12
111 0.16
112 0.22
113 0.31
114 0.41
115 0.51
116 0.57
117 0.65
118 0.69
119 0.71
120 0.74
121 0.76
122 0.71