FuNGI

A0A1Y2E2D4

Protein Details

Accession

A0A1Y2E2D4

Localization Confidence

Low

Confidence Score

9.6

NoLS Segment(s)

Position	Sequence	Protein Nature
1-26	MRGKRLHALKRPKLRQSWNKYNLYNF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 12, mito 9, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR022801 Ribosomal_S4/S9 IPR002942 S4_RNA-bd IPR036986 S4_RNA-bd_sf IPR001878 Znf_CCHC IPR036875 Znf_CCHC_sf
Gene Ontology	GO:0015935 C:small ribosomal subunit GO:0019843 F:rRNA binding GO:0003735 F:structural constituent of ribosome GO:0008270 F:zinc ion binding
Pfam	View protein in Pfam PF01479 S4
PROSITE	View protein in PROSITE PS50889 S4 PS50158 ZF_CCHC
CDD	cd00165 S4

Amino Acid Sequences

MRGKRLHALKRPKLRQSWNKYNLYNFWRQRDPKIGLKDDETFFQQKWRAKGLLRSYHGEHVRERDWERMFSRRLLSVANMDARYMAEWDGSEQAAGRGSGQDKRPNWNAPDVKPMTLTPYMNMAFAPLERRLDVAVFRALFASSARQARGMCVHGHVKVNGKVTPHPTYKLNPGDMISVNPDIVMFATGRPKGKAYVEPTPSGTASAAKNKKLRELYERGVCYACRKPGHLAAHCPGAGASEQELSVAEAESDATVSAQQAAAEQDPDTTDAPEAPVEDMKPTREAIQSLMSQAKLVLAAEAPTLKVKQKRDLRSFIKQAKPLLSRAGRPSATPSDIASELTKMVSELNLVDISNDTQEAAAQEAASSSETREPPKSIDDLTTDERKALERLIREEEENPIDPSKPYATPWRPRSYMAPFAFIPKYLEVNQNVCSAVYLRHPVARVGRAEVPTPYGYRINQLAFNWYLRRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.88
2	0.89
3	0.88
4	0.89
5	0.88
6	0.87
7	0.81
8	0.78
9	0.75
10	0.72
11	0.72
12	0.67
13	0.65
14	0.66
15	0.66
16	0.67
17	0.68
18	0.67
19	0.65
20	0.68
21	0.67
22	0.6
23	0.61
24	0.6
25	0.52
26	0.49
27	0.45
28	0.39
29	0.33
30	0.36
31	0.39
32	0.37
33	0.41
34	0.44
35	0.43
36	0.45
37	0.53
38	0.56
39	0.6
40	0.59
41	0.59
42	0.56
43	0.6
44	0.61
45	0.55
46	0.49
47	0.45
48	0.44
49	0.45
50	0.44
51	0.43
52	0.41
53	0.44
54	0.44
55	0.46
56	0.46
57	0.44
58	0.44
59	0.39
60	0.37
61	0.32
62	0.31
63	0.27
64	0.29
65	0.3
66	0.27
67	0.24
68	0.23
69	0.22
70	0.2
71	0.17
72	0.13
73	0.08
74	0.08
75	0.1
76	0.11
77	0.11
78	0.1
79	0.09
80	0.09
81	0.1
82	0.1
83	0.09
84	0.11
85	0.13
86	0.19
87	0.24
88	0.32
89	0.33
90	0.4
91	0.46
92	0.49
93	0.49
94	0.54
95	0.54
96	0.48
97	0.56
98	0.51
99	0.46
100	0.41
101	0.38
102	0.33
103	0.32
104	0.3
105	0.2
106	0.23
107	0.23
108	0.22
109	0.21
110	0.16
111	0.13
112	0.13
113	0.16
114	0.12
115	0.13
116	0.13
117	0.14
118	0.14
119	0.14
120	0.14
121	0.13
122	0.15
123	0.14
124	0.14
125	0.14
126	0.13
127	0.12
128	0.12
129	0.13
130	0.13
131	0.16
132	0.16
133	0.18
134	0.18
135	0.19
136	0.22
137	0.21
138	0.18
139	0.19
140	0.22
141	0.22
142	0.25
143	0.25
144	0.27
145	0.29
146	0.31
147	0.29
148	0.28
149	0.29
150	0.32
151	0.37
152	0.33
153	0.32
154	0.32
155	0.33
156	0.39
157	0.4
158	0.36
159	0.3
160	0.29
161	0.29
162	0.26
163	0.24
164	0.19
165	0.14
166	0.13
167	0.11
168	0.1
169	0.07
170	0.07
171	0.07
172	0.05
173	0.05
174	0.1
175	0.13
176	0.14
177	0.15
178	0.16
179	0.17
180	0.2
181	0.24
182	0.25
183	0.31
184	0.33
185	0.33
186	0.34
187	0.33
188	0.31
189	0.25
190	0.2
191	0.15
192	0.14
193	0.22
194	0.24
195	0.27
196	0.31
197	0.31
198	0.37
199	0.38
200	0.39
201	0.38
202	0.41
203	0.41
204	0.44
205	0.44
206	0.39
207	0.36
208	0.33
209	0.3
210	0.27
211	0.27
212	0.22
213	0.23
214	0.24
215	0.3
216	0.37
217	0.35
218	0.35
219	0.31
220	0.33
221	0.32
222	0.29
223	0.22
224	0.15
225	0.13
226	0.09
227	0.08
228	0.05
229	0.05
230	0.05
231	0.06
232	0.05
233	0.05
234	0.05
235	0.04
236	0.03
237	0.04
238	0.03
239	0.03
240	0.03
241	0.03
242	0.03
243	0.03
244	0.04
245	0.04
246	0.04
247	0.05
248	0.06
249	0.06
250	0.06
251	0.06
252	0.06
253	0.07
254	0.08
255	0.08
256	0.08
257	0.07
258	0.07
259	0.08
260	0.07
261	0.08
262	0.07
263	0.07
264	0.07
265	0.09
266	0.1
267	0.11
268	0.12
269	0.12
270	0.14
271	0.14
272	0.15
273	0.14
274	0.17
275	0.17
276	0.18
277	0.19
278	0.16
279	0.15
280	0.14
281	0.12
282	0.09
283	0.08
284	0.06
285	0.05
286	0.05
287	0.06
288	0.06
289	0.06
290	0.07
291	0.09
292	0.13
293	0.19
294	0.22
295	0.31
296	0.4
297	0.49
298	0.55
299	0.63
300	0.65
301	0.69
302	0.74
303	0.74
304	0.72
305	0.66
306	0.62
307	0.6
308	0.56
309	0.49
310	0.48
311	0.42
312	0.4
313	0.4
314	0.44
315	0.37
316	0.35
317	0.39
318	0.35
319	0.33
320	0.3
321	0.26
322	0.22
323	0.22
324	0.23
325	0.18
326	0.14
327	0.12
328	0.12
329	0.11
330	0.08
331	0.08
332	0.06
333	0.06
334	0.06
335	0.07
336	0.08
337	0.08
338	0.08
339	0.09
340	0.09
341	0.09
342	0.09
343	0.07
344	0.06
345	0.07
346	0.07
347	0.08
348	0.07
349	0.07
350	0.07
351	0.07
352	0.08
353	0.08
354	0.08
355	0.08
356	0.14
357	0.16
358	0.2
359	0.23
360	0.24
361	0.26
362	0.29
363	0.3
364	0.25
365	0.26
366	0.25
367	0.27
368	0.31
369	0.34
370	0.3
371	0.29
372	0.28
373	0.27
374	0.25
375	0.25
376	0.24
377	0.23
378	0.28
379	0.34
380	0.35
381	0.35
382	0.35
383	0.35
384	0.35
385	0.33
386	0.31
387	0.26
388	0.25
389	0.23
390	0.25
391	0.24
392	0.21
393	0.22
394	0.3
395	0.38
396	0.47
397	0.55
398	0.6
399	0.59
400	0.6
401	0.65
402	0.61
403	0.63
404	0.54
405	0.5
406	0.42
407	0.46
408	0.44
409	0.38
410	0.33
411	0.25
412	0.27
413	0.26
414	0.32
415	0.31
416	0.33
417	0.34
418	0.33
419	0.31
420	0.27
421	0.25
422	0.19
423	0.18
424	0.2
425	0.23
426	0.22
427	0.26
428	0.27
429	0.31
430	0.36
431	0.39
432	0.37
433	0.36
434	0.41
435	0.39
436	0.4
437	0.37
438	0.35
439	0.32
440	0.31
441	0.3
442	0.28
443	0.27
444	0.3
445	0.33
446	0.32
447	0.34
448	0.33
449	0.36
450	0.34
451	0.38

A0A1Y2E2D4

3D AlphaFold-predicted Structure Viewer