Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EIG0

Protein Details
Accession A0A1Y2EIG0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-68SMTPTIPRRKLQHRQAPRWRLATFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 8, E.R. 2, cyto 1, extr 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MSTYIRMDIAAHFPPLFHFFVALLISWVLHLAKTLSSCCHLCCQSMTPTIPRRKLQHRQAPRWRLATF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.2
4 0.15
5 0.14
6 0.12
7 0.13
8 0.13
9 0.11
10 0.08
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.04
17 0.04
18 0.04
19 0.05
20 0.06
21 0.07
22 0.07
23 0.1
24 0.11
25 0.11
26 0.16
27 0.16
28 0.16
29 0.17
30 0.19
31 0.21
32 0.25
33 0.26
34 0.29
35 0.37
36 0.44
37 0.49
38 0.52
39 0.56
40 0.61
41 0.69
42 0.73
43 0.75
44 0.78
45 0.82
46 0.88
47 0.9
48 0.87