Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EWC1

Protein Details
Accession H0EWC1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-202TRAQLIRYTRKEKKYFPRCEAKEKGPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MMSVLSNRTQRLYTLEEALKVLSLNTKPDIKTETSVNTKPDVKLESLDSTPIFTPSISTKSAVKPESDVTSEFNDYFGDVSKLENWQNLCYDLDVEDIDLGSLKKCRKALGKLNVNIVDVVEAQRNRKDSSICGGAKLESEAGKRDGWSDVASNASWEDLESVSTIRPVLKVRKFATRAQLIRYTRKEKKYFPRCEAKEKGPVRCLSKRMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.3
4 0.3
5 0.29
6 0.24
7 0.19
8 0.17
9 0.16
10 0.15
11 0.17
12 0.2
13 0.25
14 0.25
15 0.28
16 0.31
17 0.29
18 0.3
19 0.3
20 0.33
21 0.36
22 0.39
23 0.38
24 0.38
25 0.39
26 0.37
27 0.37
28 0.33
29 0.27
30 0.26
31 0.27
32 0.26
33 0.23
34 0.24
35 0.2
36 0.19
37 0.18
38 0.17
39 0.14
40 0.1
41 0.12
42 0.12
43 0.16
44 0.15
45 0.16
46 0.18
47 0.22
48 0.28
49 0.27
50 0.25
51 0.24
52 0.26
53 0.27
54 0.26
55 0.23
56 0.19
57 0.2
58 0.21
59 0.19
60 0.16
61 0.13
62 0.12
63 0.11
64 0.1
65 0.08
66 0.07
67 0.07
68 0.08
69 0.11
70 0.11
71 0.14
72 0.14
73 0.14
74 0.15
75 0.15
76 0.14
77 0.12
78 0.12
79 0.09
80 0.09
81 0.08
82 0.07
83 0.05
84 0.05
85 0.04
86 0.05
87 0.04
88 0.04
89 0.08
90 0.09
91 0.13
92 0.13
93 0.17
94 0.22
95 0.29
96 0.38
97 0.44
98 0.52
99 0.51
100 0.55
101 0.53
102 0.48
103 0.41
104 0.31
105 0.22
106 0.13
107 0.12
108 0.11
109 0.1
110 0.12
111 0.14
112 0.17
113 0.17
114 0.19
115 0.19
116 0.17
117 0.22
118 0.28
119 0.26
120 0.25
121 0.25
122 0.23
123 0.22
124 0.21
125 0.17
126 0.11
127 0.12
128 0.13
129 0.14
130 0.14
131 0.14
132 0.15
133 0.14
134 0.14
135 0.14
136 0.12
137 0.11
138 0.13
139 0.12
140 0.12
141 0.1
142 0.09
143 0.08
144 0.07
145 0.08
146 0.06
147 0.06
148 0.06
149 0.07
150 0.07
151 0.08
152 0.08
153 0.08
154 0.1
155 0.15
156 0.24
157 0.29
158 0.37
159 0.39
160 0.48
161 0.51
162 0.54
163 0.59
164 0.59
165 0.56
166 0.54
167 0.6
168 0.55
169 0.61
170 0.64
171 0.65
172 0.64
173 0.71
174 0.72
175 0.73
176 0.8
177 0.81
178 0.82
179 0.82
180 0.84
181 0.8
182 0.82
183 0.81
184 0.76
185 0.75
186 0.72
187 0.72
188 0.69
189 0.69
190 0.68
191 0.67